KEGG   Debaryomyces hansenii: DEHA2C14080gHelp
Entry
DEHA2C14080g      CDS       T01026                                 

Definition
DEHA2C14080p
Orthology
K08287  
dual-specificity kinase [EC:2.7.12.1]
Organism
dha  Debaryomyces hansenii
Brite
Enzymes [BR:dha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     DEHA2C14080g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
C:complement(1235480..1237402)
Genome map
AA seq 640 aa AA seqDB search
MSLISNRKRPRGFSEAFDTTSDKTAANKTKTSNGYFDTNSSSSGSTYNEISPSSSNNLNL
NMNINLNESDTTINTNDSNNKKVNFGMDGYNKDHAVIEDLDSECDEDDDIIILEERQIKS
TKSKRNNSDSVLTYTDAFAAYNMFNVNNTEDFEISHTSFSISNTSKKQRTNSLPQLPQVK
CFYNKPINYVLQYPKLGNIRTDIIPHQMNLPPCDDKDGHYIIKINDLFANRFVILKLLGQ
GTFGKVVECYDKVNRETVAIKIIRNIPKYRDAAKIELRILSTLKKFDNQNDNHCIHLREC
FDFRGHICIVTDLLQISLYDFLEKNKYIAFPGSHIQAISKQLIRSVTFLHDLSLIHTDLK
PENILLHDDSFNKKLLRSNTITASYISLTKLNESSSKKIPKYSKILKNPLIQIIDFGSAI
FDDEYHSSIVSTRHYRAPEIVLGVGWSFPCDMWSVGCILVELVIGEPLFKTHDNLEHLAM
IEKVCGHKIDKSMVLLSKAKENECGLQYFTDEYNGFSDDESEQDDDVIVDDELTRGNSLS
LIFPTESTPQKFINSVNLLARIDLFISSRIGLNINLDYSLSKNFDKNKHLINFGNFTFWW
FFIDLLKNLLIINPDERLTALEALDHPWFNLGIEDEGTVG
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgtcattgatttctaatagaaaaagaccaagaggtttcagtgaagcatttgatacgacg
tcagataagacagctgcaaataaaacaaaaacaagtaacggctatttcgatactaattcg
tcatcgtcggggtcaacatataacgaaatatcacccagctcgagtaataacctaaatttg
aatatgaatataaacttaaacgaatctgataccactataaatacgaatgattcgaataat
aagaaggtgaattttggaatggatggttacaataaggaccatgcggtgattgaagatttg
gattcggaatgtgacgaggatgatgatataattatcctcgaggaaagacaaattaagagt
accaaatcaaagaggaacaattctgattcggttttaacctatactgatgcatttgcggcg
tataatatgttcaatgtgaataatactgaggattttgagattagccacactagtttttct
atatcaaatacgtctaagaagcaaagaaccaattcgttgccccagttacctcaagtgaaa
tgtttctataacaaaccaatcaattatgttttgcaatatcctaagttaggaaatatcaga
acagacattattcctcaccaaatgaatttacccccgtgcgacgataaggatggccattat
attattaagattaatgatttgttcgccaatagatttgtaatactaaaactattgggacag
gggacttttggtaaagtggttgaatgctacgacaaggtaaaccgtgaaacggttgccatc
aagataataagaaatatacccaagtacagagatgctgctaagattgaattgagaatttta
tccacgttgaagaaatttgacaaccaaaatgacaaccattgtattcatcttcgtgaatgt
ttcgattttagaggacatatttgtattgtcacagatttattgcaaatttcgttatacgat
ttcttggaaaaaaataaatatattgcattcccaggttcacatatacaagccatttcaaag
cagcttatacggtcggtcacttttttgcatgacttgagtttaattcacactgatttaaaa
ccggaaaatatattattacatgatgattcgtttaacaagaagttgttgcggagtaatacg
atcacggcaagctacataagtttaacaaaattaaacgaatcatccagtaaaaagattccc
aagtattcaaagattttgaaaaatccgttgatacaaataattgactttgggagtgctatt
ttcgacgatgaatatcattcgtctattgtatcaacaaggcattatagagccccagaaatt
gtattgggtgttggctggtcgtttccgtgtgatatgtggtcggtaggatgcattttagtt
gaactagtaataggcgagcctttattcaagacgcacgataacctagagcatttggcaatg
atcgaaaaagtttgtggccataaaatagacaaatcgatggtattgttgtcgaaagccaaa
gaaaatgagtgtggattacagtatttcactgacgagtataacggatttagcgacgacgaa
agcgaacaagatgacgacgtaattgtcgatgatgagttgactagggggaacagtttatcg
ttaatatttcctacagagtctacaccccaaaaatttattaatagtgtcaacttgctagca
cgaattgatttatttatcagttccagaattggcctcaatattaaccttgattattcgttg
tcgaagaattttgataagaacaagcatttgattaattttggcaacttcacgttctggtgg
ttcttcatcgacttgctcaagaaccttttgattattaatcccgacgagagactaacggcg
ttggaggcgttggatcacccatggttcaatcttggcattgaggatgaagggactgtcggt
tga

DBGET integrated database retrieval system