KEGG   Debaryomyces hansenii: DEHA2C16456gHelp
Entry
DEHA2C16456g      CDS       T01026                                 

Definition
DEHA2C16456p
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
dha  Debaryomyces hansenii
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:dha00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    DEHA2C16456g
   00670 One carbon pool by folate
    DEHA2C16456g
Enzymes [BR:dha01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     DEHA2C16456g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
C:complement(1448332..1448952)
Genome map
AA seq 206 aa AA seqDB search
MTAANGKVTPPIAMIVAALLPELGIGIKGKMPWRLRQEIKYFKNVTTTTKDPNGINAVIM
GRKTWESIPTKFRPLPGRLNIVLSRSYVSHGSNDEDIILTNSIENALAKVEEYSKPVEKI
FVIGGSELYNKLISHEKVQHLLITEIKSTRPVEVDTWLKFPIYTESSDWTKQTNDDLSKF
TGIDNEDVEITEGDFTYKYTYWKKKV
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgacagcagctaatggaaaggtaacacctcctattgccatgattgtggcagccctttta
ccagagttaggaatcggaataaaaggaaaaatgccgtggagattgagacaagagataaag
tactttaagaatgttacaactacaactaaagaccctaacggtataaatgcggttataatg
ggccgtaagacatgggagtctatacctacgaaatttagacctctaccaggacggttgaat
atagttttgtccagatcatacgtcagtcatgggtcaaatgatgaggacattatattgaca
aattctattgaaaatgcattggctaaggttgaggaatatagcaaaccggtagagaaaata
tttgtcataggtggatcagagttatataataagctcatctcacacgaaaaagtacaacat
ttactcatcacagaaattaaaagcaccagaccggtggaagtggatacatggttgaaattt
ccgatatacacagaatcgagtgattggactaagcaaacaaatgacgatttgctgaaattc
actggaatagataatgaggacgtggaaatcacagaaggcgattttacttacaagtataca
tactggaagaaaaaagtgtaa

DBGET integrated database retrieval system