KEGG   Debaryomyces hansenii: DEHA2C16918gHelp
Entry
DEHA2C16918g      CDS       T01026                                 

Definition
DEHA2C16918p
Orthology
K11407  
histone deacetylase 6/10 [EC:3.5.1.98]
Organism
dha  Debaryomyces hansenii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
C:complement(1488497..1490929)
Genome map
AA seq 810 aa AA seqDB search
MSESFSENTETPKALESKTYDEKVDGEGVEKSTENAAKDEVSVKHELSNSEELENGHALK
RAKLEESLKNKNTIIVVPPTKPQLFYSPLKTGLVYDVRMRYHAKIFTSYFEYIDPHPEDP
RRIYRIYKKLAEAGLIQDSSLSGIDEIGPLMVKIPIREASAEEILEVHSEEHLRFIESTE
TMSRERLLEETERGDSIYVNNDSYLSAKLSCGGTIEACKAVIEGRVKNSLAVVRPPGHHA
EPDTPGGFCLFSNVAVAAKNILKRYPESVRRIVIVDWDIHHGNGTQKAFYDDPRVLYISL
HRYENGKFYPGTKYGNSTQTGEGAGEGYSLNIPWRTPGMDDGDYFYAFNKVVIPVITEFD
PDLVIVSSGFDAADGDIIGGCHVSPTGYGHMTHLLKGIAKGKLCVVLEGGYNLDSISKSA
LGVAKVLVGEPPENTIRSQPHIETLEVIDEVIKIQSKYWNCLKPGNPTNSLDDVYDLPND
NTAYKLTNIADPIRSHQVEELFNRYSFINLPIVAASKTKTEQSNSFFTTDLPPSLEDLIV
ASPDIYDCSTIIISVHDPPEIWANINPINGSIEGSASVVLEHPLTQMIEKIKKETSNNSN
IANEKIGYIDINIPSYALSIPSLNNGNSKSATQSTYNPTIFAQELLLYVWDNYLAYFSQL
KKLVFVGFGDSYQSIVHLYAKRPSSEIKNLVQGTVIFVNRSALKPLVPVMDESMVDWYYQ
NSVVFTSCLHSCWNGSSGATGTSLSRTNGSTNNGNEVNGIDNSKRPRRKFGRVLKASSDG
LWEVISERFDEGIDFVLDSIEEYSSSGSSN
NT seq 2433 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaaagtttcctggaaaataccgagacacctaaggcattggaactgaaaacgtat
gacgaaaaagtggacggtgaaggtgttgagaaaagcaccgaaaatgcagctaaagatgaa
gtaagcgtcaagcatgaactaagtaatagcgaagaacttgaaaatggccatgctttaaag
agagctaagttagaagaatctttgaagaataaaaataccataatcgttgttccacctaca
aagccgcaattgttctatagtccattgaaaaccggcttggtatatgatgtccggatgaga
tatcacgctaaaatatttacttcttattttgaatacatcgatccacatccagaggatcca
cgtcgtatttaccgtatttataagaagttggcagaggctgggttgattcaagatagttca
ttatcaggaattgatgaaatagggccgttaatggtgaagattccaatcagagaggcgtca
gcggaagagatattagaggtccattcagaagagcacttgaggtttattgaatcaacagag
actatgagccgtgaacggttattggaggaaacagagcggggtgattcgatttacgtgaat
aatgattcgtatctctctgctaaactttcgtgcggtggaactatcgaagcctgtaaggcc
gtgatcgagggtcgtgtaaagaactctcttgctgtagtgagacccccgggacatcatgct
gaacctgacacaccagggggattctgtctattcagtaacgttgcagttgccgcgaaaaat
attctcaagaggtatcctgaatcagtgagaagaattgtgattgttgattgggatatccat
catggaaatggtactcaaaaggcgttttacgatgatccaagagtattgtatatttcactt
catagatatgaaaatggtaagttttacccaggaacaaaatatggtaatagcacacaaact
ggagaaggtgctggggaaggttattcattgaatataccgtggagaacgcccggtatggat
gatggtgattatttttatgcttttaacaaagttgtaataccagttatcactgaatttgat
cctgatttggttatcgttagttcgggtttcgatgcggcagatggagatataatcggggga
tgccatgtttctcctactggttatggccatatgacccatctacttaagggaatagcgaaa
ggaaaactatgtgttgttttggaaggaggttataatttagactctatcagtaaaagtgcg
ttaggagtagcaaaagtattagttggagaaccacctgaaaatacaattaggtcacaacct
catatcgaaactttggaagttatagatgaagttattaagattcagtcaaaatattggaac
tgcttgaaacctggaaatcctaccaactcattagatgatgtctacgatttacctaatgac
aacacggcctataaactcacaaatatcgcagacccaatcaggtcacatcaagttgaagaa
ttgtttaatagatattcatttattaacttacctatagtggcagcttcaaagactaagaca
gaacaaagtaattcctttttcaccacagatttacctcctagcttggaagacttaattgta
gctagtcctgatatatatgactgctcaacaattataatatctgttcacgacccaccagaa
atatgggcaaatataaatccaatcaatggtagtatagagggaagtgcctcggttgtttta
gaacatccattgactcaaatgatcgagaagataaagaaagaaactagtaataattctaac
attgccaatgaaaaaataggatacatcgatataaatattccttcctatgcattgtctata
ccgtcattgaataacggtaattcaaaatcggcgacccaatcaacttacaatccaactata
ttcgcgcaagagttgcttctatatgtctgggacaactacttggcctacttctcccaatta
aaaaaattagtgtttgtgggatttggagattcatatcaatcaattgtacatttatacgcc
aagaggccgtcgagcgagattaaaaatttagttcaaggaactgtcatatttgttaataga
tcagcccttaaacccttggtacctgttatggatgaatcaatggtagattggtattaccaa
aattctgttgtatttactagttgccttcactcatgctggaatggatccagcggagcaacc
ggtacttctttatctagaaccaatggtagtacaaataatggtaatgaggtaaatggtatt
gacaatagtaagagaccaaggcgaaagtttggaagggttttaaaagcatcatctgatggg
ttatgggaggttattagtgagcggtttgacgaaggtattgatttcgttttggactctatt
gaagaatacagcagtagtggcagcagcaactaa

DBGET integrated database retrieval system