KEGG   Debaryomyces hansenii: DEHA2D00902gHelp
Entry
DEHA2D00902g      CDS       T01026                                 

Definition
DEHA2D00902p
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
dha  Debaryomyces hansenii
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dha00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:dha00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
D:79929..81155
Genome map
AA seq 408 aa AA seqDB search
MKLFTVIIVLVSINLVNALSFNGSDILANDNHGGKNMSNNSNPHVDFYSIKASGIRATFM
PYGARLTHLLVKDRDGNPQDVVVGYDKGDAYINDTDTVHSYFGAVVGRYANRIKKGTFEI
DDETYHVPRNENNGTNTLHGGTVGYDQRNWTVTSYNESSITFMLEDNGYEGFPGSVITYA
TYAVKTRDRRPILTTRLVSIPLDGATPISLSNHIYWSLNAFTDARNPTVLNDTLSLPYSN
RYIETDKFLVPTGDINLVQDKAGTDFIEAIELGTNIKQAVGGCGPKCTGLDTAFILDRPR
YSGPESTDLVLLTLQSNKTGIKMELKTNQQSLQIYSCDGQDGTIPVKKSQQHGNDTTYLE
QYGCVVIEPQQWIDGINNPQWAQNEFQVYGVDTQPAVNFASYEFSSFE
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaaactatttactgtaattattgttttagtctcgatcaatttagttaatgcattatcg
ttcaacggctcggatattttagcgaatgacaatcatggaggaaaaaatatgagcaacaac
tcaaaccctcatgttgatttctattccattaaagctagtggtattagggcaacattcatg
ccttacggtgctaggttaacacatttattagtaaaagatagagatggtaacccacaggat
gtagttgtggggtatgacaaaggagacgcatatatcaatgatactgatacggttcattct
tactttggtgcagttgtaggacgatacgcaaatcgtatcaagaaaggtacgtttgaaatt
gacgatgaaacataccatgttcctaggaatgaaaataacggaactaacacgcttcatggt
ggaactgttggatatgatcaacgcaactggactgttacatcatataatgaatctagcatt
acatttatgcttgaagataatggatatgaaggcttcccaggtagcgttatcacttatgcg
acttatgcagtgaagactagagacaggcggccaatattgactactaggctagtgagcatt
cctttggatggtgctaccccaattctgctttcgaaccacatatactggagtttaaacgct
tttaccgatgctcgaaatcctacagttttaaatgatactttgtcgcttccatattcaaac
agatacattgaaaccgataaatttttggttccgacgggtgacattaaccttgttcaagat
aaagctggaacagatttcattgaagccattgaattaggaactaacattaagcaagcagta
gggggttgtggtccaaaatgcactggcctcgatactgcatttattttggatcgtccaagg
tattcaggtcccgagtcaacagacttggtccttcttactttacaatcaaataaaacgggg
attaaaatggagttaaaaacaaaccaacagtctttacagatatacagttgcgacggacaa
gatggtacaattccagtcaagaaaagccaacaacatggaaatgatacaacatatttagaa
cagtatggatgtgttgtgattgagccacaacaatggattgatggtattaataacccacaa
tgggcacagaatgaatttcaagtatatggtgttgacacccaaccagcagttaattttgct
ctgtatgaattcagttcttttgaatag

DBGET integrated database retrieval system