KEGG   Debaryomyces hansenii: DEHA2D05698gHelp
Entry
DEHA2D05698g      CDS       T01026                                 

Definition
DEHA2D05698p
Orthology
K11874  
ubiquitin carboxyl-terminal hydrolase 16 [EC:3.1.2.15]
Organism
dha  Debaryomyces hansenii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
D:469296..471839
Genome map
AA seq 847 aa AA seqDB search
MSLLEQLRCLIVNRDIVGAPTQVANRNTDFVRNFLFSRTSEQQRNLIISGILVGLSFYIL
LPSISIPFLPDQKQQMFSKRPDKYTTGLINLRNDCFANSSLQAYSALPKLTEYLNEFITA
FKQLKKFMEDNGIKSELHINTQDESSGSSKFKTNNSKFEIPLHYALSKMMKSLQETRMSS
RTISVWTFLHALEKIFNAKISKSQHDAQELTQLINETLENENVKILKKLKQLRKELLNNP
NLINDLDAIQLPEFPFSGLILSQMKCLSCSFVSKPNFSPFLMLTLNAPEKSSTELETIID
ENESESIEGYQCLKCRLMKITENENHLKEIGKSNNSEDEVTILNTLFDLNNDEKLCINDD
LSPELEEYIKSYNKYGLDIANVTSTVFRRQQILKPPKIFGIHLSRSSFNGVDVTRNSCRV
SFKDQLTLSIGKEYHEELKQFQGAANEESISEDANFSSNILTNDIDDMEDEEHQREDIDE
NGNEDEENEEISTTDNGDNTTSDNEFDDGDDDSDSSSLTSTETSHTTPTIRGSTNDKQFD
AASSSTTLRTPETLNNAPITEDQTDKLRKHFRSFKFNDNDIYKYKLRALIKHQGSHSQGH
YECYKRKPLYVKDKEGVIFKLSPEILDDITGDITCDVTGISVLDPTFRDEERNASSHNKD
DSSSETVTRKKKFSFSFNNNRRGSVASSSSDNADPTSKTGSNTYDEVPNLRNINEEEYED
SSSGLRRKLSTMMGRRPSVFQADPANANIQEIIHSGLNTPAELLVDGPEVDYFSSFGGGP
QKMIPEDNEQSKKVKMRKIPSLIKHPFWRISDSEISEVSRSTVLWENSSVYMLYYERVDR
GQIKGDK
NT seq 2544 nt NT seq  +upstreamnt  +downstreamnt
atgtctttattagagcaattacgttgtttaatagtgaatagagatatagtaggtgcacca
acgcaagtggcaaatagaaatactgattttgtgagaaacttcttattttccaggacatca
gagcaacaaagaaatttgatcattagtggaattttagttggtctaagtttttatatttta
ttaccatctattagcattccatttttaccggatcaaaaacaacaaatgtttagcaagaga
ccggataagtatacgactggattgatcaatctaagaaatgattgctttgccaactcgtcg
ttacaggcgtacctggcgttaccgaaacttaccgagtacttaaatgaattcattaccgct
tttaagcaactcaagaagtttatggaagataatgggattaagtcagaactccatattaat
actcaggatgagtcaagtggaagttccaagtttaagacaaataattccaaatttgaaatt
ccgcttcattatgcgttaagcaaaatgatgaagagcttgcaggaaacgaggatgtcatca
agaaccatttcagtttggacatttcttcatgcattagaaaagatttttaatgcgaagata
tccaaatcgcagcatgatgcccaggaattgacccagttgattaacgagacgttagagaat
gaaaacgtcaagatcctcaagaaattaaagcagttgagaaaagaacttttgaacaatcca
aatttaataaatgatttggacgcgattcaattgccagagttcccatttagtgggttaata
ttgtctcaaatgaagtgtctctcttgttcttttgtttcgaaaccaaatttttccccattt
ttaatgttgactttgaatgctccagagaagtcgtcaactgaattagaaactattatagat
gagaatgaatcagaatctattgaaggctatcagtgtttgaaatgtcgcttaatgaaaatt
acggaaaatgagaatcacttaaaggaaattggaaaatcaaataacagtgaagacgaagta
acgattcttaatacattgtttgatttgaacaatgatgagaaattgtgcataaatgacgac
ctttcacccgaattagaagaatatattaaatcatataacaaatatggtttagatatcgca
aacgtcacttcaactgtatttagaaggcagcagattttaaagcccccaaagatttttggt
attcatttatctaggtctagttttaatggtgttgacgtgaccagaaattcgtgtcgtgtt
tcatttaaagatcagttgactttgtcgattggtaaggagtatcacgaagagttaaaacaa
ttccaaggcgcagccaatgaagaatcaatatcagaagatgctaactttagctcaaatatt
ttaacaaacgacattgatgatatggaagatgaagaacatcaaagggaagatattgatgaa
aacggtaatgaagatgaagaaaatgaagaaatttctacaacagacaatggtgataataca
acttccgataatgaatttgatgatggtgatgacgattcggatagctcatctttaacttca
acggaaacttcgcatacaacacctaccatcagaggtagtacaaatgacaaacaatttgat
gctgcatccagctcaactacattgagaactccagaaactttgaataatgcccctatcact
gaagaccaaacagataaattgaggaaacattttagaagcttcaaattcaatgacaatgac
atttataaatataaattgcgtgctcttattaagcatcaaggatctcatagtcagggacat
tatgaatgttataaaagaaagccattgtatgtcaaagataaagagggcgtgatctttaag
ttatcaccggaaatattggatgatattacaggtgatattacatgtgatgtcacaggaata
tctgtacttgatcctacattcagggatgaggaacgtaacgcatcatcacataataaagac
gatagttctagtgaaaccgttactagaaaaaagaagttttctttttcttttaacaataat
agacgtggctcggtcgcttcctcctcatccgataatgctgatccaactagcaaaaccggt
tcaaacacttacgatgaagtacctaacttaaggaacatcaatgaagaagaatatgaagac
tctagttctggtcttcgtcgtaaactttcaacgatgatgggacgtagaccatcagtcttc
caggctgatccagcgaatgctaatatccaagagattattcattctggtttgaatactcct
gctgagctattagttgatggcccagaagtggattatttctcttcttttggaggaggacct
caaaagatgattcccgaggacaacgaacaatcaaaaaaggtcaagatgagaaagattcca
tcgttgattaagcatcctttttggaggattagtgattccgaaatttccgaagtttcaaga
tcaactgttctatgggaaaattcgagtgtttatatgctttattatgagagggttgataga
ggacaaattaagggtgataaatag

DBGET integrated database retrieval system