KEGG   Debaryomyces hansenii: DEHA2D06402gHelp
Entry
DEHA2D06402g      CDS       T01026                                 

Definition
DEHA2D06402p
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
dha  Debaryomyces hansenii
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:dha00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    DEHA2D06402g
Enzymes [BR:dha01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     DEHA2D06402g
Glycosyltransferases [BR:dha01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   DEHA2D06402g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
D:519583..522087
Genome map
AA seq 834 aa AA seqDB search
MSKRSSRQNAAANAAAAARKGQDNTGILTIDPVMEPQFENGQYREYLVTTASPLLSKKRN
VTSKEYLLVAGLLVCAFYVRCSNLAYPNSVVFDEVHFGGFARKYILGQFFMDVHPPLTKM
LFGAAGLFGGFKGDFDFKAIGNEFPDTTPYVTMRYFPALMGVGTILLCYLTLRNSGCRPI
ICLITSAALMLENANVTISRYILLDSPLLFFIASAIYAFKKFEVQVPFSFGWYKCLVGCG
IALGLAVSSKWVGLFTIAWVGVCCVFQLWFIIGDLSLNCKKVAKHFVVRGGLLLGIPIFL
YLLFFSVHFKLLANEGDGSAFMSSAFRASLKGNAIPRDITANVGFGSAVTIRHLETQGGY
LHSHNHFYPAGSKQQQITLYPHLDSNNDWIIEPYNETMPDSFVPITDGMKIRLKHANTGR
RLHSHDEKAPVSERDWQKEISCYGFDGFDGDANDDFFIEIVEHKSAPGEAQSSVRALQTV
FRLRHVMTGHYVFSSAVKLPDWGFEQQEVTAASQGYRPLTHWYIETNRNTRVNSTIEEIV
NYPVLSFWDKVTELHKRMWKINQGLTDHHNWQSSPHEWPLLLRGINYWVKDHRQVYFLGN
AVVWWASSAAIVTFAIHALFSIVRWQTGARVAGNKHVFNFNSQVFLYTVGWALHYFPFFI
MGRQLFLHHYIPAIYFAILALGHFFDILVSYLTARYKMLNKVSYGALGLFLTFALLFYVQ
YSSLIYGTPWTREKCEASKAIGTWDFDCNAFLNNINEYSTLLTTATQTPIPEDPAAPSDA
LEAKEAKETPQAAQKKVAKEEEHQSEAENAEEPKSDEKVEELVPPLAADIEETK
NT seq 2505 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagagaagcagtaggcaaaacgcagctgccaatgctgcagctgctgctcgtaaa
ggacaagataatacgggcattttgacaattgatcctgttatggagcctcaatttgagaac
ggtcagtacagagagtatttggtgaccacagcgctgccattattgagtaaaaagcgtaat
gtgacgtcgaaggaatatcttttggttgctgggttgttggtatgtgctttttacgtgaga
tgttcgaacttggcgtaccctaactcggtagtgtttgacgaagtacatttcggagggttt
gcacggaagtacattttggggcaatttttcatggatgtgcacccgccattgaccaagatg
cttttcggggctgcaggattgttcggtgggttcaagggagactttgatttcaaggcgatt
ggaaacgaattcccagacacgacgccatacgtgacgatgcgttatttcccggcattgatg
ggcgtgggtacgattttgttgtgctacttgacattgagaaactctggctgtagacctatt
atttgtcttattaccagtgccgccttaatgcttgagaacgcaaatgtgactatttccaga
tacatcttgttggactctccattgttgttctttatcgcgtcagctatctatgcgtttaag
aagtttgaagtgcaagttccattctcgtttggttggtacaaatgcttggttggatgcggt
attgctttaggtttagcagtcagctccaaatgggtcggtttattcactattgcttgggtt
ggtgtatgttgtgtcttccaactctggttcattattggtgatttgtctctcaactgcaaa
aaagtggcaaaacattttgttgtacgtggtggtttgttattgggaattcctattttctta
tacttattatttttttcagttcatttcaagttattagctaacgagggtgatggatctgca
ttcatgtcgagtgcttttagagcttcgttgaagggtaatgcaatccctagagatatcact
gcaaacgttggatttggttcggctgttactattcgtcacttggaaacccaagggggttac
ttgcattcccacaatcatttctatccagccggttcaaagcaacaacaaattacgttatac
ccacatttagattctaacaatgattggattattgaaccttataatgaaaccatgcctgac
tcctttgttcctattactgacggaatgaaaatcagattgaagcatgctaataccggtaga
agattacattcacatgatgaaaaggcccctgtcagtgaaagagattggcagaaggaaatt
tcatgttacggatttgatggatttgacggtgacgctaatgatgacttttttatcgaaatt
gttgagcataaatcggcaccaggtgaagcccaatcttctgtcagagctttacaaacagtt
ttccgtttaagacacgttatgactggacactatgttttctcaagtgctgttaagttacca
gattggggctttgaacaacaagaggtcactgctgcttcacaaggttacagaccattaact
cactggtatattgaaactaacagaaatacccgtgttaatagtaccatagaggaaatcgta
aactatcctgttctctcattctgggataaagtcacagaattacataagagaatgtggaag
atcaatcagggtttaactgaccaccataactggcagtcttctccacatgaatggccatta
ttattgagaggtattaactattgggttaaggatcacagacaagtttactttttgggtaac
gccgtagtctggtgggcttcttcagcagccattgtcacatttgcaatccatgcattgttc
tctatagtcagatggcaaactggtgctcgtgttgctggaaataagcatgtcttcaacttt
aattctcaagtattcttatacacagttggttgggcattgcattatttcccattttttatc
atgggcagacaattatttttacaccattatatccctgctatttattttgccatattagct
ttgggccacttttttgatattcttgttagttatctcactgcaagatataagatgttaaac
aaagtttcttatggtgcattaggattattcttaacctttgcgttattattctatgtccaa
tattcttcgcttatttacggtactccttggactcgtgaaaaatgtgaagcttccaaggct
ataggaacttgggattttgattgtaatgcttttttgaataacatcaacgagtattcaaca
ttacttactacagctacacaaaccccgatcccagaggatccagctgctccgagcgatgcg
cttgaagcaaaggaagcgaaggagacccctcaagctgctcaaaagaaagttgcaaaagaa
gaggaacatcaatctgaggctgaaaatgctgaggaaccaaaatctgatgaaaaagttgaa
gaacttgttccaccattagctgctgatattgaagagacaaaataa

DBGET integrated database retrieval system