KEGG   Debaryomyces hansenii: DEHA2D10186gHelp
Entry
DEHA2D10186g      CDS       T01026                                 

Definition
DEHA2D10186p
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dha  Debaryomyces hansenii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dha00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DEHA2D10186g
   01230 Biosynthesis of amino acids
    DEHA2D10186g
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DEHA2D10186g
   00030 Pentose phosphate pathway
    DEHA2D10186g
   00051 Fructose and mannose metabolism
    DEHA2D10186g
   00052 Galactose metabolism
    DEHA2D10186g
  Energy metabolism
   00680 Methane metabolism
    DEHA2D10186g
Enzymes [BR:dha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     DEHA2D10186g
Protein phosphatases and associated proteins [BR:dha01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     DEHA2D10186g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
D:complement(841497..844340)
Genome map
AA seq 947 aa AA seqDB search
MTVPVVNGSSCLSLYGKNRDLILQAINFYTNVVGLTKDSEESGSVYLRSNNSKVVIKLEE
SDEALSGSEVKQFTEGLVSSLGVNDWRSIESCITLMVKDLNQLVVALEENNYPVQISPNE
LYPDEVYTVDPLGNVVGFTVCFNPLTVNPPVKKLAPWNPEQDTMSASTSEFSKIGENGGS
SKKRRNIAVMTSGGDAPGMNAVVFAVVRAAIFRGSKAFCVMEGYEGLIRGGSEYIKEMHW
QDVRSYLSEGGTNIGTARCMAFKERQGRLTACKHLIESGIDALIVCGGDGSLTGADLFRK
EWPSLIKELKDTNAINEEKYETYKHLNICGVVGSIDNDMATTDATVGAYSSLARICQAID
YIDATANSHSRAFVVEVMGRHCGWLALMAGIATSADYILIPEKPASSKDWQEQMCEIVQK
HRAKGKRKTIVIIAEGAITLDLKPISSNDVKDILVNRLGLDTRVTVLGHVQRGGTAVAYD
RIIGTLQGVEAVKAVLDCTPQTPSPLIAITENKVVRKSLVEAVEITKSVATAIEERDFEK
AMSLRETEFVEHLNNFMSMNSANHNEPTLPIEKRKKIAIINIGAPAGGMNSAVYSMATYC
MSRGHIPYAIYNGFTGLSRHESVRSMDWLDIEGWTSVGGSEIGTNRATPDETDIGMIAYY
FEKYQFDGLILVGGFEAFVSLDQLEKARSMYPAFRIPMVLIPATISNNVPGTEYSLGSDT
CLNALMEYCDVVKLSASATRGRVFIIEVQGGNSGYIATFASLVSGAQASYVPEEGIALGQ
LEMDISSLKEAFSIERGISKAGKLLLKSTNASKVLTTQVLANVINQEANGEFDAKTAIPG
HVQQGGLPSPIDRTRGARFAIKAVQYIEDTFDDIRPYRYEMNFPTDNKKVQATAAVLGVE
SSHLKFRSIRKLYDFETELNKRMPKKISWNEVRDIADQLVGRTRIQK
NT seq 2844 nt NT seq  +upstreamnt  +downstreamnt
atgactgttccagtggtaaatggtagttcgtgtctatcattgtacggaaagaatagggac
ttaatattacaggcgattaatttttacaccaatgtggttgggttgaccaaagattccgag
gagtcggggtcggtgtatttgagatccaacaactcgaaggtggttatcaagttggaggaa
tcggacgaagctctttctggtagcgaggtcaagcagttcaccgagggcttggtatccctg
ttgggtgtgaatgactggagatcaattgagtcgtgcattactttgatggtgaaggatttg
aaccagttggtggttgcgttggaggagaacaattatccggtacaaatatctcctaatgaa
ttgtatccggatgaagtgtacactgttgatccgcttgggaacgtagttggatttacggtg
tgtttcaatccgttaacggtgaatcctcctgtcaagaagttggcgccatggaacccagaa
caagacaccatgtcagcttcgacctctgaattctccaaaattggcgaaaatggcggttca
tccaagaaaagaagaaacattgctgtgatgacttcaggtggtgatgctccaggtatgaat
gcagtggtgttcgccgttgttagagccgcgatttttagaggatccaaggccttctgtgtt
atggaaggatatgaaggtttgatcaggggtggttccgaatacattaaggagatgcattgg
caagatgttagaagttatctttcagaaggtggtaccaatattggtactgctagatgtatg
gcctttaaagaaagacaaggtagattgactgcttgtaaacatttaattgaaagtggtatc
gacgccttgattgtatgtggtggtgacggttcgttaactggtgctgatttatttagaaag
gaatggccatcgttgattaaagaattgaaggatactaacgctataaacgaagaaaaatac
gaaacctataagcatcttaatatatgtggtgtcgttggttctattgataacgatatggca
acaactgatgctactgttggtgcttattcatcgttggctagaatctgtcaagcgattgat
tacattgacgccactgctaattctcactctagagcttttgttgttgaagtcatgggtagg
cattgtggttggttagctttaatggcgggtatagccacaagcgccgattatatcttgatt
ccagaaaagcctgcgtcttcgaaggattggcaagagcaaatgtgtgaaattgttcaaaag
cacagagctaaaggtaagagaaagacgattgttatcatcgctgaaggtgcaatcacattg
gacttgaagcctatttcatcaaatgatgtgaaagatattcttgttaacagattaggattg
gataccagagtaaccgttttgggtcacgttcaaagaggtggtactgctgttgcatatgat
cgtattattggtaccttacaaggtgtcgaggctgtcaaagcggtccttgactgtacaccg
caaacaccatctccattgattgccatcacagaaaataaggttgtaagaaaatcattagtg
gaagcggtggagattactaagtctgtcgctacagccattgaagaacgtgattttgagaag
gctatgtcattaagggaaacagagtttgtcgaacacttgaataatttcatgtccatgaat
agtgcaaaccacaacgagccaaccttacctattgaaaaaagaaagaagattgctataata
aatataggtgcacctgctggagggatgaacagtgcagtctattccatggcgacgtattgt
atgtcaagaggacatattccatatgctatttacaatgggtttacaggattatcaagacat
gaatctgtgagactgatggattggttggatattgaaggatggacatcagttggtggatca
gaaattggtaccaatagagcaactccagatgagactgacataggaatgattgcatactat
tttgaaaaatatcaatttgatggattaatactagtaggaggttttgaagctttcgtttcg
ttggaccagttggaaaaggcaagatcgatgtatcccgcatttagaattccaatggtttta
attcccgcgactatttcaaacaatgtaccaggaactgaatattcgttaggttcagacaca
tgtttgaatgccttaatggaatactgtgacgtggttaaactttcagcatccgctacaaga
ggacgtgtatttattattgaggttcagggtggcaattcgggctatattgctacatttgcg
tctttagtttcaggtgcacaagcttcttatgttccagaagaaggcatagcattaggacaa
ttggaaatggatatcagttcgttaaaggaggcattttcaattgaaagaggtatttctaag
gcgggtaaattactcttgaaaagtactaatgcttcaaaagtattaactactcaagttctt
gcaaatgtcattaaccaggaggctaatggagaatttgatgctaagactgctattccgggt
catgttcaacaaggtggcttaccttctccaattgacagaaccagaggtgctagatttgcc
atcaaagcagtacaatacatcgaagacacctttgatgatatccgcccatatagatatgaa
atgaactttccaactgataataagaaggtgcaagctacggctgctgtattgggagttgaa
tcttctcacttgaaatttagatccattagaaagctttacgattttgaaacggaacttaat
aagagaatgcctaagaaaatttcttggaacgaagtaagagatattgctgaccagttagta
ggtagaactcgcatacaaaaataa

DBGET integrated database retrieval system