KEGG   Debaryomyces hansenii: DEHA2D11836gHelp
Entry
DEHA2D11836g      CDS       T01026                                 

Definition
DEHA2D11836p
Orthology
K00866  
choline kinase [EC:2.7.1.32]
Organism
dha  Debaryomyces hansenii
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:dha00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
D:990530..992206
Genome map
AA seq 558 aa AA seqDB search
MDITHANIYNPNQTRSRSKSRTRNSTANSRSTSSTRRPTFGRKRSLSSSSTSKLTITPTT
LDDERLIPTAQATLDNSVPLDFFKQDIIAMVKALRIGKWHKRQLTIANLSVNRISGALTN
SIYKLTYIDEQQNFSLPTLLLRVYGKNLDSIIDRERELSVLVKLSQRNIGPKLLGIFSNG
RFEQFLDGFSPLDKDNLRDEIISQMLGRRMKDLHYKVELSNEDVKGLPMCWKLIYKWLQI
FEDTVLPSYGHCGVKEEEIFLMKFDQFKDLIKKYEKWLLSHYDTELLASNYKFCHNDTQY
GNLLLHESFDASDIIISHPPSSANLLSDKKSAVIKSTSNKKDSSLAVIDFEYSGPNFPAF
DLANHFCEWMADYHDPEKSYYIYEENYPSRLEQLNLIKSYVEYDFQFPSSNLKHAFDKDV
TQVNAADLIQFEIKKLHNECILWRPAVQIYWCLWGLIQNGPVRPTVANNNHNSSEKVIDS
TYSITVGVDTLRLEENAIREEEEEITSSDDDFDYLKYAQQKSGLTIGDLLQFDLINKEDI
PEEHVKDIKHLDCDFFDL
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atggatataactcacgcgaatatatataacccaaatcaaacgagatctcgatcgaagtca
agaacaaggaattcaaccgcaaattctcgatcaacaagttcaactaggagacctactttt
ggacgtaaaaggtcactttcttcatcatcgaccagtaagctcactataacaccaacgact
cttgacgatgaaagattaattccaactgctcaagcaacgttagataatagtgttccatta
gatttttttaaacaggatattattgctatggtcaaagcgcttcgaattggtaaatggcat
aaaagacaattgacaattgctaacttgagcgtgaatagaatttcaggagcattaactaac
tcgatctataagttaacatatattgacgaacaacagaattttctgttacctactttgtta
ttgagagtttatggaaagaacttagattcgataattgatagagagagggaattaagtgtt
ttggtcaaattgtcccagagaaacattggccctaaattgttaggtatattttcaaatggt
agatttgaacagtttttagatggattttcaccgttagataaagataatcttagagatgaa
atcatttctcaaatgttggggagaaggatgaaagatttgcattacaaagttgaattaagc
aatgaagatgttaaaggattgcccatgtgttggaagttgatttataaatggctccagatt
tttgaagatacagtcttaccaagttatggccactgtggggtaaaggaagaagagatcttc
ttgatgaagttcgatcaatttaaagacttgataaaaaaatatgagaaatggttgctctct
cattatgatactgaattacttgcttccaattacaaattctgtcacaatgacactcagtat
ggtaatctcttgttgcatgaatcgttcgatgcaagcgatattattatatcgcacccacca
tcttcagctaatttgctcagtgataagaaatcagcggttatcaaatcgactagcaataag
aaagatagcagtttagcagttattgattttgagtattccggtccgaatttcccagcattt
gatttagcaaatcatttttgcgagtggatggctgattatcacgatcctgaaaaatcgtat
tatatatacgaagaaaattatccgagcagattagagcaattgaacttgatcaaatcctat
gttgaatacgacttccaattcccttcatctaacctcaagcacgcttttgacaaggacgtc
acccaggtcaacgctgctgatttaattcaattcgagataaagaaattgcacaacgaatgt
attctttggagacctgccgtgcaaatttactggtgtctttggggtttaattcaaaatggt
ccagttagaccaactgttgctaataataatcataactcttccgaaaaagtaatcgatagt
acatacagcattactgttggtgtggatacattaagattggaagaaaatgcaattagagaa
gaagaagaagaaatcacttcatctgatgacgactttgattatttgaagtacgcccaacaa
aaatccggtcttactataggtgaccttttgcaatttgaccttataaacaaggaggatatc
cctgaagaacacgttaaggatataaagcacttagattgtgatttttttgatctttaa

DBGET integrated database retrieval system