KEGG   Debaryomyces hansenii: DEHA2D12320gHelp
Entry
DEHA2D12320g      CDS       T01026                                 

Definition
DEHA2D12320p
Orthology
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
dha  Debaryomyces hansenii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dha00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    DEHA2D12320g
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DEHA2D12320g
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DEHA2D12320g
Enzymes [BR:dha01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     DEHA2D12320g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
D:complement(1031094..1033196)
Genome map
AA seq 700 aa AA seqDB search
MSVLLKETFARCKKEGRNALVNFITAGYPTIEDTLPILKGMQKAGVDIIELGVPFSDPIA
DGPTIQAANVVALNNGITVTKCLDLVAQARAEGVTVPILLMGYYNPILKYGEQRMIEDSA
KAGANGYIVVDLPPEEAVKFRSLCTTNGLSYVPLVAPATTDERLKLLGEIADSFIYVVSR
MGTTGATVSVTNDISELCNRVRKFAGDTPIAVGFGVSTREHFLTVGEAADGVVIGSKIIT
LIGESKPGERGDTAYKYVRSILGNDYQTNAPESFKASERSEAKSTNPSFEEIHKYNPRFG
DFGGQYVPEALHTCLAELERGFEDAVADPKFWEEFKSLYSYIGRPSSLHRADRLTEYAGG
AQIWLKREDLNHTGSHKINNALAQVLIARRLGKKKIIAETGAGQHGVATATAAAKFGLEC
TVFMGAEDVRRQALNVFRMRILGAKVVAVTNGTQTLRDATSEAFRFWVSNLESTHYVVGS
AIGPHPYPTLVRTFQSVIGNETKEQFKELNGGKLPNVVVACVGGGSNSTGMFSPFENDTE
VKLLGVEAGGDGIDTERHSATLTAGIPGVFHGVKTYVLQDSDGQVHDTHSVSAGLDYPGV
GPELAFWKSTGRATFVAATDAEALHGFKLLSQLEGIIPALESSHAIFGAVEVAKNLPKDQ
HIVINVSGRGDKDVQSVAEVLPKLGDKIGWDLRFEDDPSK
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atgtctgttttattaaaagaaacatttgctaggtgcaagaaagaaggccgtaatgcgttg
gtcaacttcattactgctggttatccaaccattgaagatactttaccaatcttaaaaggt
atgcagaaggcgggtgtcgatattatcgaattaggagttccgttttccgatcctattgct
gatggtccaactattcaagcagctaatgtcgttgctttaaataacggaattactgttact
aaatgtttagatttggtagctcaggcaagagccgaaggtgtcaccgtgccaattttattg
atgggttactacaatccaattttaaagtatggtgaacaaagaatgattgaagattccgcc
aaggccggtgcaaatggttacattgttgttgatttgccacctgaagaagcagttaaattc
agatcattgtgtactactaatggtttatcatacgttccattggttgctccagcgactact
gatgagcgtttgaagcttcttggtgaaatagctgattcattcatttacgtggtttccaga
atgggtaccactggtgctactgtcagcgtaacgaatgatatttctgaattatgtaacaga
gtcagaaaatttgctggagatacgcctatagctgttggtttcggtgtttcaactagagag
catttcttgaccgtcggtgaagcagctgatggtgttgtcatcggatcaaaaattatcacc
ttaattggggaatcaaaacctggtgaaagaggcgacactgcctataaatatgttagatcc
attttgggtaatgactaccaaacaaatgctccagagctgtttaaggctagtgaaagaagt
gaagctaagtccactaatccttcattcgaagaaatacacaagtataatccaagatttggt
gacttcggaggtcaatatgttccagaggcattacatacttgtttagctgaattagaaaga
ggatttgaggatgctgttgctgaccctaagttctgggaagagtttaaatctttatactca
tacattggtagaccatcatctttgcatagagctgataggttaaccgaatacgcaggcggt
gctcaaatttggttgaaaagagaagatttaaatcatactggttcccataagattaataat
gctttagctcaggttttaattgcaagaagattaggtaaaaagaaaattattgcagaaacc
ggtgctggacaacatggtgttgcaactgccactgctgctgccaaatttggtttggagtgt
accgttttcatgggagctgaggatgttaggcgtcaagctttaaatgttttcagaatgaga
attttaggcgcaaaagttgttgctgtcactaacggtacccaaacattaagggatgctact
tcagaagctttcagattttgggtttctaatttagaaagtacccattacgttgttggctct
gcaattggcccacatccttatccaaccttagttagaactttccaaagtgttattggtaac
gaaaccaaagaacaattcaaagaattaaatggtggtaaattaccaaatgtcgtggtcgcc
tgtgttggtggtggttctaattcgacaggtatgttttctccattcgaaaatgatactgag
gttaagttgttaggtgttgaagccggtggtgacggtattgatactgaacgtcattcagca
accttgactgctggtatccctggtgtgttccacggtgtaaaaacttacgttttacaagat
agtgatggtcaggttcatgatactcattctgtttctgctggtttggattatccaggtgtc
ggcccagaattggcattttggaagagcactggtagagcaacatttgttgccgctactgat
gctgaagctttacatggcttcaagttattatctcaattggaaggtattattccagcttta
gagtcttcacatgctatttttggtgccgttgaggttgctaagaatttgccaaaggaccaa
cacattgttatcaatgtttcaggtagaggtgataaggatgtccaaagtgtcgcagaggtt
ttaccaaaattgggtgataagattggctgggatttgagattcgaagatgatccttccaaa
tag

DBGET integrated database retrieval system