KEGG   Debaryomyces hansenii: DEHA2D12320gHelp
Entry
DEHA2D12320g      CDS       T01026                                 

Definition
(RefSeq) DEHA2D12320p
  KO
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
dha  Debaryomyces hansenii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dha00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    DEHA2D12320g
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DEHA2D12320g
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DEHA2D12320g
Enzymes [BR:dha01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     DEHA2D12320g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
D:complement(1031094..1033196)
Genome map
AA seq 700 aa AA seqDB search
MSVLLKETFARCKKEGRNALVNFITAGYPTIEDTLPILKGMQKAGVDIIELGVPFSDPIA
DGPTIQAANVVALNNGITVTKCLDLVAQARAEGVTVPILLMGYYNPILKYGEQRMIEDSA
KAGANGYIVVDLPPEEAVKFRSLCTTNGLSYVPLVAPATTDERLKLLGEIADSFIYVVSR
MGTTGATVSVTNDISELCNRVRKFAGDTPIAVGFGVSTREHFLTVGEAADGVVIGSKIIT
LIGESKPGERGDTAYKYVRSILGNDYQTNAPESFKASERSEAKSTNPSFEEIHKYNPRFG
DFGGQYVPEALHTCLAELERGFEDAVADPKFWEEFKSLYSYIGRPSSLHRADRLTEYAGG
AQIWLKREDLNHTGSHKINNALAQVLIARRLGKKKIIAETGAGQHGVATATAAAKFGLEC
TVFMGAEDVRRQALNVFRMRILGAKVVAVTNGTQTLRDATSEAFRFWVSNLESTHYVVGS
AIGPHPYPTLVRTFQSVIGNETKEQFKELNGGKLPNVVVACVGGGSNSTGMFSPFENDTE
VKLLGVEAGGDGIDTERHSATLTAGIPGVFHGVKTYVLQDSDGQVHDTHSVSAGLDYPGV
GPELAFWKSTGRATFVAATDAEALHGFKLLSQLEGIIPALESSHAIFGAVEVAKNLPKDQ
HIVINVSGRGDKDVQSVAEVLPKLGDKIGWDLRFEDDPSK
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atgtctgttttattaaaagaaacatttgctaggtgcaagaaagaaggccgtaatgcgttg
gtcaacttcattactgctggttatccaaccattgaagatactttaccaatcttaaaaggt
atgcagaaggcgggtgtcgatattatcgaattaggagttccgttttccgatcctattgct
gatggtccaactattcaagcagctaatgtcgttgctttaaataacggaattactgttact
aaatgtttagatttggtagctcaggcaagagccgaaggtgtcaccgtgccaattttattg
atgggttactacaatccaattttaaagtatggtgaacaaagaatgattgaagattccgcc
aaggccggtgcaaatggttacattgttgttgatttgccacctgaagaagcagttaaattc
agatcattgtgtactactaatggtttatcatacgttccattggttgctccagcgactact
gatgagcgtttgaagcttcttggtgaaatagctgattcattcatttacgtggtttccaga
atgggtaccactggtgctactgtcagcgtaacgaatgatatttctgaattatgtaacaga
gtcagaaaatttgctggagatacgcctatagctgttggtttcggtgtttcaactagagag
catttcttgaccgtcggtgaagcagctgatggtgttgtcatcggatcaaaaattatcacc
ttaattggggaatcaaaacctggtgaaagaggcgacactgcctataaatatgttagatcc
attttgggtaatgactaccaaacaaatgctccagagctgtttaaggctagtgaaagaagt
gaagctaagtccactaatccttcattcgaagaaatacacaagtataatccaagatttggt
gacttcggaggtcaatatgttccagaggcattacatacttgtttagctgaattagaaaga
ggatttgaggatgctgttgctgaccctaagttctgggaagagtttaaatctttatactca
tacattggtagaccatcatctttgcatagagctgataggttaaccgaatacgcaggcggt
gctcaaatttggttgaaaagagaagatttaaatcatactggttcccataagattaataat
gctttagctcaggttttaattgcaagaagattaggtaaaaagaaaattattgcagaaacc
ggtgctggacaacatggtgttgcaactgccactgctgctgccaaatttggtttggagtgt
accgttttcatgggagctgaggatgttaggcgtcaagctttaaatgttttcagaatgaga
attttaggcgcaaaagttgttgctgtcactaacggtacccaaacattaagggatgctact
tcagaagctttcagattttgggtttctaatttagaaagtacccattacgttgttggctct
gcaattggcccacatccttatccaaccttagttagaactttccaaagtgttattggtaac
gaaaccaaagaacaattcaaagaattaaatggtggtaaattaccaaatgtcgtggtcgcc
tgtgttggtggtggttctaattcgacaggtatgttttctccattcgaaaatgatactgag
gttaagttgttaggtgttgaagccggtggtgacggtattgatactgaacgtcattcagca
accttgactgctggtatccctggtgtgttccacggtgtaaaaacttacgttttacaagat
agtgatggtcaggttcatgatactcattctgtttctgctggtttggattatccaggtgtc
ggcccagaattggcattttggaagagcactggtagagcaacatttgttgccgctactgat
gctgaagctttacatggcttcaagttattatctcaattggaaggtattattccagcttta
gagtcttcacatgctatttttggtgccgttgaggttgctaagaatttgccaaaggaccaa
cacattgttatcaatgtttcaggtagaggtgataaggatgtccaaagtgtcgcagaggtt
ttaccaaaattgggtgataagattggctgggatttgagattcgaagatgatccttccaaa
tag

DBGET integrated database retrieval system