KEGG   Debaryomyces hansenii: DEHA2D12760gHelp
Entry
DEHA2D12760g      CDS       T01026                                 

Definition
DEHA2D12760p
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
dha  Debaryomyces hansenii
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:dha01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:dha01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dha00010]
Metabolism; Energy metabolism; Methane metabolism [PATH:dha00680]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:dha00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
D:1076376..1077137
Genome map
AA seq 253 aa AA seqDB search
MAVHKLIILRHGESEWNHENRFCGWIDIPLSEKGRDEAKFAGHLIQKYNLKPTITYTSKL
TRSIQTGDIILEELGRLWCDVVKTWRLNERHYGAFQGRDKNEVYRELGAEKYQYIRRNYN
GTPPPMETQYKDDCIDERYEVDDVDIADLPRGESLKLVMERVIPYLRKEIVEGSLIGDNK
TVLVVTHGSIVRSVIKYFKGVSDADISKINVPTGVPMVFELDDDCNMVKDYYYLDPELAK
KGIEKVSNEGTKK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggctgtccataaattaataatattacgtcacggagaatcggaatggaatcatgaaaac
aggttctgtgggtggatcgatataccattaagtgaaaagggccgggatgaggccaagttt
gctggccacttgattcaaaagtacaatcttaaaccaacaattacttacacatcgaaattg
acgagatcgatacagacaggcgacattattctcgaagaattgggccggttgtggtgcgat
gttgtgaagacatggaggttgaatgaaagacactacggggcattccaagggagagataag
aacgaggtgtaccgtgaattgggcgcggaaaagtaccagtatatcagaagaaactacaac
gggacaccaccaccaatggaaactcaatataaggatgattgtatcgatgagaggtacgaa
gtggatgatgttgatattgcagatcttccacgaggcgaatcgttgaagttagtgatggag
agagtgattccgtatttacggaaggaaattgttgaaggaagcttaattggcgacaataag
acggtgcttgtggtaacacacggaagtatagtgaggagcgtgattaagtatttcaagggt
gtgagtgatgctgatatctcgaagatcaacgttcctaccggggttccgatggtgtttgaa
ttggatgacgattgtaacatggtgaaggactactactatcttgatccagagttggcaaag
aaaggaattgagaaggtaagcaacgagggcaccaaaaaatag

DBGET integrated database retrieval system