KEGG   Debaryomyces hansenii: DEHA2D12760gHelp
Entry
DEHA2D12760g      CDS       T01026                                 

Definition
DEHA2D12760p
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
dha  Debaryomyces hansenii
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dha00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DEHA2D12760g
   01230 Biosynthesis of amino acids
    DEHA2D12760g
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DEHA2D12760g
  Energy metabolism
   00680 Methane metabolism
    DEHA2D12760g
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DEHA2D12760g
Enzymes [BR:dha01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     DEHA2D12760g
Exosome [BR:dha04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   DEHA2D12760g
  Exosomal proteins of melanoma cells
   DEHA2D12760g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
D:1076376..1077137
Genome map
AA seq 253 aa AA seqDB search
MAVHKLIILRHGESEWNHENRFCGWIDIPLSEKGRDEAKFAGHLIQKYNLKPTITYTSKL
TRSIQTGDIILEELGRLWCDVVKTWRLNERHYGAFQGRDKNEVYRELGAEKYQYIRRNYN
GTPPPMETQYKDDCIDERYEVDDVDIADLPRGESLKLVMERVIPYLRKEIVEGSLIGDNK
TVLVVTHGSIVRSVIKYFKGVSDADISKINVPTGVPMVFELDDDCNMVKDYYYLDPELAK
KGIEKVSNEGTKK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggctgtccataaattaataatattacgtcacggagaatcggaatggaatcatgaaaac
aggttctgtgggtggatcgatataccattaagtgaaaagggccgggatgaggccaagttt
gctggccacttgattcaaaagtacaatcttaaaccaacaattacttacacatcgaaattg
acgagatcgatacagacaggcgacattattctcgaagaattgggccggttgtggtgcgat
gttgtgaagacatggaggttgaatgaaagacactacggggcattccaagggagagataag
aacgaggtgtaccgtgaattgggcgcggaaaagtaccagtatatcagaagaaactacaac
gggacaccaccaccaatggaaactcaatataaggatgattgtatcgatgagaggtacgaa
gtggatgatgttgatattgcagatcttccacgaggcgaatcgttgaagttagtgatggag
agagtgattccgtatttacggaaggaaattgttgaaggaagcttaattggcgacaataag
acggtgcttgtggtaacacacggaagtatagtgaggagcgtgattaagtatttcaagggt
gtgagtgatgctgatatctcgaagatcaacgttcctaccggggttccgatggtgtttgaa
ttggatgacgattgtaacatggtgaaggactactactatcttgatccagagttggcaaag
aaaggaattgagaaggtaagcaacgagggcaccaaaaaatag

DBGET integrated database retrieval system