KEGG   Debaryomyces hansenii: DEHA2D12936gHelp
Entry
DEHA2D12936g      CDS       T01026                                 

Definition
DEHA2D12936p
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
dha  Debaryomyces hansenii
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:dha01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:dha00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
D:1088647..1090299
Genome map
AA seq 550 aa AA seqDB search
MPYTKIDVNEEEKFFQDQVKEIQQWWKEPRWAKTKRIYQAEDIAKKRSSLKVDYPSSNQA
KKLYKLLQEHDKNKSASFTFGALDPVQVTQMAKYLDSIYVSGWQCSSTASTSNEPSPDLA
DYPMDTVPNKVEHLWFAQLFHDRKQREERLNLSKEERAKTPYTDFLRPIIADADTGHGGI
TAILKLTKLFVERGAAGIHIEDQAPGTKKCGHMAGKVLVPVQEHINRLVAIRASADILGS
DLLCVARTDSEAATLLTSTIDHRDHYFVLGATNPESPDLAALMAEAESNGIYGDKLASIE
VEWTKKAGLKLFHEAVIDEINNGNFSNKQALIKKFTDKVNPLSATSNKEARKLAREILGK
DVFFDWDVARAREGYYRYQGGTQCAVMRGQAYAPYADMIWMESALPDFKQAKEFAEGVKA
KWPDQWLAYNLSPSFNWNRAMPPNEQETYIKRLSELGYVWQFITLAGLHTTALAVDDFAN
QYSQIGMRAYGQTIQAPEIEKGVEVVKHQKWSGAEYIDGLLKMVTGGVSSTAAMGAGVTE
DQFKEKAAGK
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgccatacactaaaatagacgttaacgaagaagaaaaattcttccaagatcaagttaaa
gagatccaacaatggtggaaagaacctcgttgggccaaaaccaagagaatctaccaagct
gaggatattgccaagaagagaagtagtttgaaggttgactacccatcttctaaccaagct
aagaagttatacaagttgttacaagagcatgacaagaacaagagtgcatcattcacattc
ggtgccttggacccagtgcaagtgacccaaatggccaagtacttggactccatctatgtt
tccggatggcaatgttcttctactgcttctacttctaacgagccatccccagatttagct
gattaccctatggataccgttccaaacaaggttgagcacttatggtttgctcaattattc
cacgacagaaagcaaagagaggaaagattgaatctttccaaggaagaacgtgctaagacc
ccatacactgatttcttgagacctatcatcgctgatgctgacactggtcacggtggtatt
actgctattcttaaattgaccaagttattcgttgaaagaggtgctgcaggtattcatatt
gaagatcaggctccaggtaccaagaagtgtggacatatggctggtaaggttttagttcca
gttcaagaacacattaaccgtttagttgccatcagagcatctgctgatatcttagggtct
gacttattatgtgttgctagaactgactctgaagctgctactttacttacctcaaccatt
gaccacagagaccactacttcgttcttggtgctaccaacccagaatccccagatttggct
gccttgatggctgaggctgaatctaatggtatctacggtgataaattagcttctatcgaa
gtcgaatggaccaagaaggctggtttgaaattattccacgaagccgtcattgatgaaatc
aacaacggtaacttctccaacaaacaagctttgatcaagaaattcaccgacaaggttaac
ccattatccgctacttctaacaaggaagctagaaaacttgccagagaaatcttaggtaag
gatgttttctttgactgggatgttgcaagagctagagagggttactacagataccaaggt
ggtactcaatgtgccgttatgagaggtcaagcatatgctccatacgctgatatgatttgg
atggaatccgcattaccagacttcaagcaagccaaggaattcgctgaaggtgttaaggct
aaatggcctgatcagtggttagcttacaacttgtctccatctttcaactggaacagagct
atgccacctaatgaacaagaaacctacatcaagagattaagtgaattaggttacgtctgg
caattcatcaccttagccggtttacatactactgctttggctgtggatgatttcgctaac
caatactctcaaatcggtatgagagcttacggtcaaactatccaagctcctgaaatcgaa
aagggtgttgaagttgttaagcatcaaaaatggtctggtgcagaatacattgatggttta
ttaaagatggtcactggtggtgtctcttctactgctgctatgggtgctggtgttactgaa
gaccagttcaaagaaaaggctgctggtaagtaa

DBGET integrated database retrieval system