KEGG   Debaryomyces hansenii: DEHA2D12936gHelp
Entry
DEHA2D12936g      CDS       T01026                                 

Definition
DEHA2D12936p
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
dha  Debaryomyces hansenii
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:dha00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DEHA2D12936g
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    DEHA2D12936g
Enzymes [BR:dha01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     DEHA2D12936g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
D:1088647..1090299
Genome map
AA seq 550 aa AA seqDB search
MPYTKIDVNEEEKFFQDQVKEIQQWWKEPRWAKTKRIYQAEDIAKKRSSLKVDYPSSNQA
KKLYKLLQEHDKNKSASFTFGALDPVQVTQMAKYLDSIYVSGWQCSSTASTSNEPSPDLA
DYPMDTVPNKVEHLWFAQLFHDRKQREERLNLSKEERAKTPYTDFLRPIIADADTGHGGI
TAILKLTKLFVERGAAGIHIEDQAPGTKKCGHMAGKVLVPVQEHINRLVAIRASADILGS
DLLCVARTDSEAATLLTSTIDHRDHYFVLGATNPESPDLAALMAEAESNGIYGDKLASIE
VEWTKKAGLKLFHEAVIDEINNGNFSNKQALIKKFTDKVNPLSATSNKEARKLAREILGK
DVFFDWDVARAREGYYRYQGGTQCAVMRGQAYAPYADMIWMESALPDFKQAKEFAEGVKA
KWPDQWLAYNLSPSFNWNRAMPPNEQETYIKRLSELGYVWQFITLAGLHTTALAVDDFAN
QYSQIGMRAYGQTIQAPEIEKGVEVVKHQKWSGAEYIDGLLKMVTGGVSSTAAMGAGVTE
DQFKEKAAGK
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgccatacactaaaatagacgttaacgaagaagaaaaattcttccaagatcaagttaaa
gagatccaacaatggtggaaagaacctcgttgggccaaaaccaagagaatctaccaagct
gaggatattgccaagaagagaagtagtttgaaggttgactacccatcttctaaccaagct
aagaagttatacaagttgttacaagagcatgacaagaacaagagtgcatcattcacattc
ggtgccttggacccagtgcaagtgacccaaatggccaagtacttggactccatctatgtt
tccggatggcaatgttcttctactgcttctacttctaacgagccatccccagatttagct
gattaccctatggataccgttccaaacaaggttgagcacttatggtttgctcaattattc
cacgacagaaagcaaagagaggaaagattgaatctttccaaggaagaacgtgctaagacc
ccatacactgatttcttgagacctatcatcgctgatgctgacactggtcacggtggtatt
actgctattcttaaattgaccaagttattcgttgaaagaggtgctgcaggtattcatatt
gaagatcaggctccaggtaccaagaagtgtggacatatggctggtaaggttttagttcca
gttcaagaacacattaaccgtttagttgccatcagagcatctgctgatatcttagggtct
gacttattatgtgttgctagaactgactctgaagctgctactttacttacctcaaccatt
gaccacagagaccactacttcgttcttggtgctaccaacccagaatccccagatttggct
gccttgatggctgaggctgaatctaatggtatctacggtgataaattagcttctatcgaa
gtcgaatggaccaagaaggctggtttgaaattattccacgaagccgtcattgatgaaatc
aacaacggtaacttctccaacaaacaagctttgatcaagaaattcaccgacaaggttaac
ccattatccgctacttctaacaaggaagctagaaaacttgccagagaaatcttaggtaag
gatgttttctttgactgggatgttgcaagagctagagagggttactacagataccaaggt
ggtactcaatgtgccgttatgagaggtcaagcatatgctccatacgctgatatgatttgg
atggaatccgcattaccagacttcaagcaagccaaggaattcgctgaaggtgttaaggct
aaatggcctgatcagtggttagcttacaacttgtctccatctttcaactggaacagagct
atgccacctaatgaacaagaaacctacatcaagagattaagtgaattaggttacgtctgg
caattcatcaccttagccggtttacatactactgctttggctgtggatgatttcgctaac
caatactctcaaatcggtatgagagcttacggtcaaactatccaagctcctgaaatcgaa
aagggtgttgaagttgttaagcatcaaaaatggtctggtgcagaatacattgatggttta
ttaaagatggtcactggtggtgtctcttctactgctgctatgggtgctggtgttactgaa
gaccagttcaaagaaaaggctgctggtaagtaa

DBGET integrated database retrieval system