KEGG   Debaryomyces hansenii: DEHA2D15884gHelp
Entry
DEHA2D15884g      CDS       T01026                                 

Definition
DEHA2D15884p
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
dha  Debaryomyces hansenii
Brite
Enzymes [BR:dha01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     DEHA2D15884g
Transfer RNA biogenesis [BR:dha03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    DEHA2D15884g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
D:complement(1327446..1329122)
Genome map
AA seq 558 aa AA seqDB search
MPSVQKQKTGKQKLAPEKERFLQCCGDISLELVASLKNSKDINLNGLIIRYAKKYKLKQQ
PRLTDIISSIPDQYKKYLIPKLKAKPVRTASGIAVVAVMCKPHRCPHIAYTGNICVYCPG
GPDSDFEYSTQSYTGYEPTSMRAIRARYDPYEQARGRVEQLRQLGHSIDKVEYIIMGGTF
MSLPVEYRENFITQLHNALTGFNGRDIDEAIKFSQQSQTKCVGITIETRPDYCTETHLSD
MLKYGCTRLEVGVQSVYEDVARDTNRGHTVKSVCETFAVAKDAGYKVVSHMMPDLPNVGM
ERDLEQFKEYFENPDFRTDGLKLYPTLVIRGTGLYELWKKGLYKSYNANALIDLVARILA
LVPPWTRIYRVQRDIPMPLVTSGVENGNLRELALARMKDFGTTCRDVRTREVGIQEVHHK
VAPDQVELIRRDYYANGGWETFLSYEDPKKDILIGLLRLRKASKKFTYRKEFTSQQTSIV
RELHVYGSVVPLHSRDPRKFQHQGFGTLLMEEAARIARVEHGSEKISVISGVGVRNYYAK
LGYHLDGPFMSKWLNEEE
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgccatctgtccagaaacaaaagacagggaaacaaaaattagcgccagaaaaggaaagg
tttcttcaatgttgtggagatatttctttggaattggttgcatcgttaaagaattcaaag
gatataaacttaaatggattaattataagatatgctaagaaatataagttaaagcaacag
cctagattgacagatattatatcttctattccggatcaatataaaaaatatttgataccc
aagttaaaggcaaagccagttagaactgcatcgggtattgcagttgttgctgttatgtgt
aaacctcatagatgccctcatattgcatacacgggtaatatatgtgtgtactgtcctggt
gggccagattctgattttgaatattctacgcaatcgtatactgggtatgaacctacgtcg
atgagagccatcagagccagatacgacccgtacgaacaagcgaggggtagagttgaacag
ttaagacaattggggcattcaatcgacaaggtggaatacattattatgggtggtacgttc
atgtcattgccagttgaatacagagagaattttattacacaattacataatgccttaact
ggttttaatggtcgtgatattgatgaagcaattaaattttcccaacagtcccagactaaa
tgtgttggtataacgattgaaactcgtccagattattgtacggaaacccacttgagtgac
atgttgaaatatggatgtaccagacttgaagttggtgtccagtcggtttatgaagacgtt
gcaagagataccaatagaggtcacacagtaaagtctgtgtgtgagacttttgcagtcgcc
aaggacgctggttacaaggtagtcagtcatatgatgccggatcttccaaatgttggtatg
gaaagagatttggagcaattcaaggaatacttcgaaaaccctgatttcagaactgacggg
ttaaaattatacccaaccttagttatcagaggtactggtttatatgaattatggaaaaag
gggttatacaagtcatataacgctaacgcattaatcgatctcgttgcacgtattttagca
ttagttccaccttggacacgtatttaccgtgttcaaagagatatccctatgccactcgtc
acctcaggtgtcgaaaacggtaatttgagagagttggcattggcgagaatgaaggatttc
ggtacaacatgtagggatgtacgtacaagagaagttggtattcaagaagtccatcataaa
gttgctcctgatcaagttgaattaattagaagagattattatgctaatggtgggtgggaa
acgttcttgtcttatgaagatcctaagaaagatattttaattggtttattgaggttgcgt
aaagcatccaaaaaattcacttatcgtaaagagttcacaagtcaacaaacttctattgtt
agagaattgcacgtttatggttcagttgtaccattgcactctagagatccaaggaagttc
cagcatcaaggtttcgggacattattgatggaagaagctgccagaattgcaagagtggaa
catggatcagaaaaaataagtgtcatttctggtgttggtgtcagaaactattatgcaaaa
ttgggataccatttggatggcccatttatgtctaaatggcttaacgaggaagagtaa

DBGET integrated database retrieval system