KEGG   Debaryomyces hansenii: DEHA2E01078gHelp
Entry
DEHA2E01078g      CDS       T01026                                 

Definition
(RefSeq) DEHA2E01078p
  KO
K18338  
L-rhamnono-1,4-lactonase [EC:3.1.1.65]
Organism
dha  Debaryomyces hansenii
Pathway
Fructose and mannose metabolism
Brite
KEGG Orthology (KO) [BR:dha00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    DEHA2E01078g
Enzymes [BR:dha01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.65  L-rhamnono-1,4-lactonase
     DEHA2E01078g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
E:88880..89902
Genome map
AA seq 340 aa AA seqDB search
MPSKKYKIIDSHVHLFAKRNFKLLKFDEAHPLHSDFRLDEYLKYSMNEEFQIDGLVFIET
DPIADLSKALEGCEYPIQEYLYVARNITGNLLPDEGETSELKQNFIKAIVPWAPMPLGKS
SVSSYVEMLKSRSSTDEFNLVKGFRYLVQDKLPNTMLQRDFVESLKWLDDNNFIFDWGID
LRCGGLWQFEETIEVLKQVPNLKYVINHLTKPNLSIDPTKIEENDEFLQWKNYMKQIFVN
SPNSYMKLSGGFSELPSEIIENRDKCAEYIYPWFKVCFDLWNVDRTIWASNWPVCTLTAG
EDLTSKWFEVTEMLFDKIELNEESRKKIYGTNYLKAYNLI
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgccttcaaaaaaatataaaattatagattcacatgttcatttatttgcaaaacgaaac
tttaaactattgaaatttgatgaagcccacccattgcattcagattttcgtctagatgaa
tacttaaaatattcaatgaatgaagagttccaaattgatggattggtttttattgagact
gacccaattgctgatttatcaaaggcacttgaagggtgtgaataccccattcaagaatat
ctttatgtagctagaaatattactggaaacttactaccagacgaaggggaaacgtcagag
ttaaaacagaattttattaaggcaattgtaccatgggctccaatgcctttgggaaagagc
ctggtaagtagttatgttgaaatgttaaagagtagatctctgactgatgaatttaatttg
gtgaaaggtttccggtatttagttcaggataaactcccaaatactatgctacagagagat
tttgttgaatctttaaaatggttggatgataataatttcatatttgactggggtatcgat
ttgagatgtggtggtttatggcaatttgaagaaactattgaagttctcaagcaagttcct
aatttaaaatatgttattaaccatttgacaaagccaaacttgagtattgacccaacaaag
attgaagaaaacgacgagtttcttcaatggaaaaattatatgaaacaaatctttgtcaat
tctccgaactcttatatgaaattatccggaggcttttcagagttaccgtctgaaataatt
gaaaatagggataaatgtgctgaatatatctatccttggttcaaagtttgttttgatctt
tggaatgtcgatagaacaatatgggcaagtaattggcctgtttgcactcttactgccggt
gaagacttgacatcaaagtggtttgaagttaccgaaatgttatttgataaaattgaatta
aatgaagaatcgaggaagaaaatctatggtactaattatttaaaagcgtataatcttata
taa

DBGET integrated database retrieval system