KEGG   Debaryomyces hansenii: DEHA2E03586gHelp
Entry
DEHA2E03586g      CDS       T01026                                 

Definition
(RefSeq) DEHA2E03586p
  KO
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
dha  Debaryomyces hansenii
Pathway
MAPK signaling pathway - yeast
AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:dha00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    DEHA2E03586g
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    DEHA2E03586g
Enzymes [BR:dha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     DEHA2E03586g
Protein kinases [BR:dha01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   DEHA2E03586g
Chromosome [BR:dha03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     DEHA2E03586g
Exosome [BR:dha04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   DEHA2E03586g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
E:304049..305131
Genome map
AA seq 360 aa AA seqDB search
MNNEQPPPQQAHTRQISFNVSDHYQILEVVGEGAYGIVCSAIHKPTNQKVAIKKIEPFER
SMLCLRTLRELKLLKHFNHENIISILAIQRPINFNLFNEIYLIQELMETDLHRVIKTQKL
SDDHIQYFIYQTLRALKTMHSANVLHRDLKPSNLLLNSNCDLKICDFGLARSIASSEDNF
GFMTEYVATRWYRAPEIMLTFQEYTTAIDVWSVGCILAEMLVGRPLFPGRDYHNQLWLII
EVLGTPNMEDYYNIKSKRAREYIRSLPFVKKVPFANLFNSEAINPLAIDLLENLLVFNPA
KRITVDNALNHPYLNIYHDPNDEPISEKIPEDFFDFDKRKDELSIEDLKKLLYDEIMKPL
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaacaatgaacaaccaccaccacaacaggctcacacgagacaaatttcgttcaacgtg
tcagaccactatcagattctcgaagtggtaggtgaaggggcatatgggatcgtttgctca
gctatccacaagcctacaaaccagaaggttgctataaagaaaatcgagccatttgaaagg
tcgatgctatgccttcggacccttcgagagttgaagttgcttaaacatttcaatcatgaa
aacattatttctatccttgccatacagcgacctatcaacttcaacttatttaacgaaatc
tacttgattcaggagcttatggagactgatttacacagggttatcaagacgcagaagcta
agtgacgatcacatccagtactttatttatcagacattgcgggcattgaagaccatgcac
ctggcaaatgtattgcatcgagacttgaagccttcgaacttgttgttgaactccaactgt
gatttgaagatctgtgactttggattggctcgatccattgcgtccagcgaggataacttt
ggatttatgactgagtatgtggccacaaggtggtatagggccccagaaatcatgttaacg
ttccaggaatatactactgccattgacgtgtggtctgtgggatgtattttggctgaaatg
ttggtgggaagaccgttgtttccggggagagactaccataaccaactttggcttatcata
gaggtattgggaacacctaacatggaagactactataatattaagctgaaacgtgctcga
gaatatattcgttcgttacccttcgtgaagaaggttccatttgcaaacttgttcaacagt
gaggccattaacccattagctatcgacttattggaaaacttgttggtatttaatccggcg
aagagaataacagtggacaatgcattgaaccacccataccttaatatataccacgacccg
aacgacgagccgatctctgaaaagatccccgaagatttctttgatttcgataaacgtaaa
gatgagttatcaattgaagacttgaagaaacttctctatgatgaaattatgaaaccgtta
taa

DBGET integrated database retrieval system