KEGG   Debaryomyces hansenii: DEHA2E03894gHelp
Entry
DEHA2E03894g      CDS       T01026                                 

Definition
DEHA2E03894p
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
dha  Debaryomyces hansenii
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dha00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DEHA2E03894g
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DEHA2E03894g
  Amino acid metabolism
   00310 Lysine degradation
    DEHA2E03894g
Enzymes [BR:dha01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     DEHA2E03894g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
E:complement(325423..326751)
Genome map
AA seq 442 aa AA seqDB search
MLSRSIKTTTRRLPSVCKKPVLQTGAKIGNVMMTRSIQTESYKSVRDMNKMSNNMLNFKR
FASQTVKVPEMAESITEGTLSEYLKEVGDFVNQDETIATIETDKIDVEVNAPVSGTITER
LVEVEENVTVGQDLVKIEEGEAPAGGAKEESKEESKEEPKKEESAAPKKEEAPKPKKEEA
PKPKKEEPKKEAKKETSKSGEEATFTNFSRNEERVKMNRMRLRIAERLKESQNTNASLTT
FNEVDMTNLMEMRKLYKDEFLDKTGIKLGFMGAFAKASTLAMKEIPSVGASIENNDTLVF
RDYADISVAVATPKGLVTPIVRNAESLSILGIEKSISDLGRKARDGKLTLEDMTGGNFTI
SNGGIFGSLYGTPIINLPQTSVLGLHGVKQRPVTVNGQIESRPMMYLALTYDHRVLDGRE
AVIFLRTIKELIEDPRKMLLLQ
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgttgtccagaagtattaaaactactactcgtcgcttacctagtgtttgcaaaaagcca
gtattgcaaactggggccaaaattggtaatgtcatgatgaccagatcgattcaaactgaa
agctacaagtccgtgagagatatgaacaagatgagcaacaacatgttgaacttcaagcgt
tttgcatcccaaactgttaaggttccagaaatggccgaatctatcactgagggtacttta
tctgaatacctcaaagaggtcggtgattttgtcaaccaagacgaaactattgccacaatt
gaaaccgataagattgatgtcgaagtgaatgctccagtgagtggtactatcaccgaacgt
ttagttgaggttgaagaaaatgtgactgttggccaagacttggtgaagatcgaagaaggt
gaagccccagctggcggtgccaaggaagaatcaaaggaagaatccaaggaagagccaaag
aaggaagaatctgctgctccaaagaaggaagaagccccaaagccaaagaaggaagaagcc
ccaaagccaaagaaagaagagccaaagaaggaagccaagaaggaaacttccaagtctggt
gaagaagccaccttcaccaacttctctagaaacgaagaaagagtcaagatgaacagaatg
cgtttgagaattgctgaacgtcttaaggaatcgcagaacaccaacgcttccttgaccacc
ttcaacgaagtcgacatgactaacttgatggaaatgagaaaattatacaaggacgaattc
ttggacaagaccggaatcaagttaggtttcatgggtgctttcgctaaggcttccacttta
gccatgaaggaaattccctctgttggtgcctccatcgaaaacaacgataccttagttttc
agagactacgctgatatttctgtcgctgttgccactccaaagggtttagttaccccaatt
gtcagaaatgccgaatccttatccatcttaggtatcgaaaagtctatctctgacttaggt
agaaaggccagagatggtaaattaaccttagaagacatgactggtggtaacttcaccatc
tctaacggtggtatcttcggttctttatacggtaccccaatcatcaacttgcctcaaact
tctgtcttaggtttacatggtgttaagcaaagacccgttactgttaacggccaaattgaa
tcaagaccaatgatgtacttagctttaacctatgatcacagagtcttagatggccgtgaa
gctgttatcttcttgagaacaatcaaggaattgattgaagacccaagaaagatgttatta
ttgcaatag

DBGET integrated database retrieval system