KEGG   Debaryomyces hansenii: DEHA2E04400gHelp
Entry
DEHA2E04400g      CDS       T01026                                 

Definition
DEHA2E04400p
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
dha  Debaryomyces hansenii
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:dha00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    DEHA2E04400g
Enzymes [BR:dha01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     DEHA2E04400g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
E:368691..373325
Genome map
AA seq 1544 aa AA seqDB search
MSTIEIVSTVAEYTEIHSPVSSKFLLPSARDSSSSISLFSAIFWFWSWLFFKIMNIFLYY
IPNIIVNLFSVNFQITLSLSSIVITLTGIISFCFLIVRYKYLTRYSKTTKSTDKPKSSNK
NIDLVGSIKKNKRGDSKSTSNYLDEFLSAIKVFGYLERPVFHELTRNMTTQKLSSEEILY
LDEKLGFSIVVEGTIQVYTKVNSVNSSTTSNSDDNELNFEKDDLLTIGDQCYQLLNEVKS
GSPLSSLMSTLDLFKPVDPDTMSNRLFSPFELDSNPASNPLSPDNTGSKSFDPLSSGNFN
DTSLSSSDRNYPNIVARPKPIEDSNNLNTATIAIIPYSAFQKVQSKYPKATSHIVTMVIT
RLYKITMNTIHSYLGLTREIIRSEIQLNESEGAKDSLPSYLYDGVIEKFYGDKNNETLLN
KTAESPSVSINKTSSSSSSLPKKSTTSLRPLNRNQSSRYVVLDSRSKSTHPGDLLSSVPL
SRRSDYYQTHTTIQPDPEEVRSQSRTKMTSPVLPKRQISSNGGPTLKGHSSSTTKFENIR
DRTFSDEREETEETSLRIAIIENIFKILGINEVSNMIGSMSDLNSRSSSVNSSVVGLPSL
MNNGNESKYPNGIFDFNTGKVRYDSISSFPTSLNKGANNNLKFYDTVNQSQLKDMDHEND
KSSQVDINNLMFKRKSIPIQSFESNFYDVKNEFSKHLNIKYFGPNTTLVEQESFNSGLYY
VIDGTLDVFYKPASKESENLTPMNKKKLYTVKSGGLAGYLSSIIGVRSLVSISTPGDKGV
IVAHIPKNEFSKLLDKFYFLQLPVASKLKSLLSSQILTIDYALEWCHIPAGDVLCSQGDL
ANGFHIVLSGRFRVVRYNNNKSSEVNPDDNTDIHDYNNNLIDESLSYKSRKKKDDITILG
EYGHGETIGEVEVLTASRRTNSLIAVRDSETARIPRTLFEMLSLRNPSIMVKVSRIVANK
MAKKDNIGIPSTISSNVPLIVTNTDSHISNDYKTITILPTVSGLPVRDFADKLVSALKNI
GRNVIALDQASTLTHLGRHAFDERLAQLKLSGYFAYLEEEYQTIVYVCDTPLKSNWTSTC
ISQGDCILLLADADDDDVATNIGEYERLLMKLKTTARTDLCLIHADKYVEPGSTSVWLKN
RIWVQGHHHIQMEIARDNSVQQGQKTSIIKNIAAKISSRTNTNIKSRLENVKTKAILSLN
KFNNRLSRRTHSYKTVQAHKNDFLRLARILSNESVGLVLGGGGSRGISHVGVVMALEKHG
IPIDLIGGTSIGSFVGGLYAKDYNIVSIYGRAKRFAKRVSSWWRMVLDLTYPVTSYITGY
EFNRGIWKIFGSSEIEDFWIRYFCNSTNITNSTMDIHESGFSWRFIRASMSLAGLLPPIT
YGGSMLLDGGYLDNLPVMEMKKKGAKYIIAVDVGSVDDRTPMNYGDTLSGFWVLFNRWNP
FSRHPNVPNMMDIQLRLAYVASVNALELAKKTPGVIYLRPPIDDYATLDFAKFDEIYHVG
MAYADNLLTRWEQTGKIPPIAGMIDRSRIRNGEERKSLYRRSSI
NT seq 4635 nt NT seq  +upstreamnt  +downstreamnt
atgagtacaattgaaatagttagtactgtcgcagaatacacggaaattcattcccctgtg
tcactgaaattcctcttaccatctgcaagagattccagttcatcaatatcgctttttagt
gctatcttttggttttggctgtggctattcttcaagataatgaacatatttttgtactac
attccaaatataatagtcaatttgttctcggttaattttcagattacattgtcattgtca
tcaattgttatcactttaacaggtataatatcgttctgcttcttaatagtcagatataag
tatcttacgcgatattctaaaacgaccaaatcaaccgataagcccaaatcgtctaataaa
aacattgacttggtcggatctataaaaaagaacaagagaggagattcaaaatcgacatca
aattatttggatgaatttttaagtgctattaaggtatttggatatttggagagaccagta
tttcatgaattaactaggaacatgacaacgcaaaagttgtcactggaggaaatattatat
ctagatgaaaagttgggctttctgattgtcgtcgaaggtactatacaagtatatactaag
gttaacagtgtcaattcgagtacaacttcaaatagtgatgataatgaattgaacttcgaa
aaagacgatctattaactattggagatcaatgttaccaattattgaatgaagtgaaaagt
ggatcgccgttatcttcattgatgagtacgttagatttgtttaagccagtcgatcctgat
actatgtcgaatcgattgttttctccatttgaattagattctaatccggcttcaaatcct
ctaagtcctgataacactggctcaaagtcgttcgatccactcagctcgggtaattttaac
gatacatctttaagctcaagtgatcgcaattatcctaacattgtggcaagacctaagcct
atcgaagattcaaataatctcaacacggcaacgattgcaattattccgtatctggcattt
cagaaagttcaatctaaataccctaaggctacatcgcatattgtaacaatggttataact
agactatacaagataaccatgaatacgatacatagctacttaggcttaacaagagaaatc
atacgtagtgaaatccaactaaatgaatctgaaggtgccaaggatagtttacccagttat
ttatatgacggtgttattgaaaagttttatggcgataaaaacaatgaaactttattgaat
aaaacagcagaaagcccttctgtatcaataaataagacatctagtagttcttcctcgtta
cctaaaaagtcaactactagtttaagaccgttaaatagaaatcaatcttcaagatatgtt
gtgttggattctcgttcaaaatctactcatcctggagatttgctttcttctgtacctcta
tctaggagatctgattattatcaaactcataccacaattcaaccagatcccgaagaagtg
cgcagtcaatcacgaactaagatgacttcacctgtcttacccaaacgtcaaatatcatca
aatgggggaccgactttgaaaggacattcgtcttctaccacaaagttcgaaaatattaga
gatagaacattctctgatgaaagagaagaaactgaagaaacttctttacgaattgctatc
attgaaaatattttcaaaattttaggaatcaatgaagtttcaaatatgattggcagtatg
tcagacttaaattcaagaagttcatcagttaattcttcagtagttggattgccaagttta
atgaataatggcaatgaaagtaaatatccaaatggaatttttgattttaatacaggcaaa
gtaaggtacgattcgattagcagtttcccaacttctttgaataaaggagcaaataataat
ttaaaattttacgatactgtgaatcaatcacagttgaaagacatggatcatgagaatgac
aaatcaagccaagtcgatatcaacaatttaatgttcaaaagaaaatctattcccatacaa
tcatttgagtcgaacttttatgacgtaaagaatgagttttctaagcatttgaatattaag
tattttggtccaaatacgacacttgttgaacaagaatcttttaattcaggtttatattat
gttattgacggcacattggatgtgttttacaagcctgctagtaaagaatctgaaaattta
actccaatgaataagaagaaattatatacggtaaaatctggtggtttggcaggttattta
agttctatcataggcgttcgctcgttagtttcgatatcgacacctggagataaaggtgtt
attgttgctcatattcctaaaaatgaattctctaaattattagataaattttacttctta
caattacccgttgcttcaaaattgaagagcttattatcaagtcagattttgactattgac
tatgctttggagtggtgccatattccggctggtgacgtactatgttcgcaaggagatttg
gcaaatggtttccatattgttttgagtggtagatttagggttgtcagatacaacaataac
aaaagctctgaagtaaaccctgatgataatacggatatacatgactataataataattta
attgatgagtcgcttagttataagtcccgaaagaaaaaagatgatattactattctagga
gaatatggtcatggagaaacaattggtgaagttgaagtattgactgcttccagaagaacc
aattcgttaattgcagttagagattcagaaactgctaggattccgagaactctttttgaa
atgctttcgttacgaaatccttctattatggtgaaggtttcgagaattgtcgctaataaa
atggcaaagaaagataatattggcatccccagtactataagcagtaatgttcctctcatt
gttacaaatacagattcccatatttcaaacgactataagacaattacaattttaccaaca
gttagtgggttacctgttagagattttgcggataaattagttctggccttgaaaaatatt
gggcgtaatgttatcgcattagatcaggcatcaactttgactcatcttgggcgtcatgct
tttgacgaaagattggcacagttgaagttgtcgggttattttgcatacttagaagaagaa
taccaaacaattgtttatgtttgtgatactccattaaaatcaaattggacttctacatgt
atttcacaaggtgattgtatattgttattagcagatgcggacgatgacgatgtggctact
aatatcggtgaatacgaaagattgcttatgaagttgaagactacagcaagaactgacttg
tgcctaattcatgccgacaagtatgttgaacctggctcaactagtgtttggcttaaaaat
cgtatatgggtgcaaggacaccatcatattcaaatggaaattgctagagataacagtgtg
caacagggacaaaaaaccagcattattaagaacatcgctgcaaaaataagtagtaggact
aatactaatattaagtctaggcttgaaaatgttaaaacaaaggcaattttatctttgaat
aaattcaacaatcgtttgagtcgcagaactcattcttataaaacagtacaagcccataag
aatgactttttgcgattagcaagaatcttgtctaatgaaagtgttggcttggtactaggc
ggaggagggtccagaggtatttctcacgtaggtgtggtaatggccttagaaaaacatggc
attccaattgatttgatagggggtacttcaattggatcatttgtcggcggattgtacgca
aaggactacaacattgtttcgatctatggtagagccaagagatttgccaagagagtatct
tcctggtggagaatggtgttagatttgacatatccagtgacatcgtatattacaggatat
gaattcaataggggtatttggaagatttttggatcaagcgaaattgaagatttttggatc
agatacttttgtaattctacaaatatcacaaattcgactatggatatccacgagagtggt
ttcctgtggagatttattagagcctcaatgtccttggcgggtttattaccccccatcacg
tacggcggaagcatgttattggatggtggttatttagataatttgcctgtcatggaaatg
aagaaaaagggtgcaaaatatataattgctgtagatgttggctctgttgatgacagaacc
ccaatgaactacggtgatactttatctggattttgggtactattcaacagatggaaccct
ttttcaaggcatccaaacgtaccaaatatgatggacatacaattaagactagcatatgtt
gcaagtgttaatgcattagagctagcaaaaaagacccctggtgttatctatttaagacct
ccaattgatgactacgctactctagactttgctaaattcgacgaaatttatcatgttgga
atggcttatgcagataacttacttaccaggtgggagcaaactggtaaaattccacctatt
gccggtatgatcgacaggtcgagaatcagaaatggtgaagaaaggaagtcattatataga
aggagctctatttag

DBGET integrated database retrieval system