KEGG   Debaryomyces hansenii: DEHA2E04906gHelp
Entry
DEHA2E04906g      CDS       T01026                                 

Definition
DEHA2E04906p
Orthology
K04646  
clathrin heavy chain
Organism
dha  Debaryomyces hansenii
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:dha00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    DEHA2E04906g
Exosome [BR:dha04147]
 Exosomal proteins
  Proteins found in most exosomes
   DEHA2E04906g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
E:404523..409532
Genome map
AA seq 1669 aa AA seqDB search
MSNDIPIDFTELASLTELGIQQSSLDFRSTTLESDHYVCVREQGSSGNTVAIIDLKNNNA
VTRKNMSADSAILHPGQLVISLRANGTTLQIFNLGTKQRLKSFTMDQAVVYWKWLDNENL
GLVTANSIYTWSIFDGSNDGPVKLTDRHHTLNNCQIINFVAEPQLNWFAVTGIAQEEGRI
AGHIQLFSKSRNVSQAIEGHVCKFGQVKLNGALHPTKVFCVGNKNAQGQGNLHIIEIDHV
EGNPDFSKKSVDIFFPPDAANDFPISLQASDKYGIVYILTKYGFIHLYDMETGSNLFVNR
ITADPVFTAAPYNDGTGIITINKSGQVLSVEISQSKIIPYVLEKLSNVPLALALSSRGGF
PGAENLFSQQFQNYLNQGDYTNAAKVAASSEQLRTQDTINKLKHITPQPGQISPILQYFS
TLLDRGTLNKYESIELAKPVLQQDRKPLFEKWLKEDKLTSSEELGDIVKSYNDAGLALAV
YIRANVNIKVVSCLAELGQFDKIMPYCEKVGYKPDYTNLIQNLVRVNPDKASEFATSLLA
SSDTDLKIENIADLFFSQNYIQQGTAFLLDALKNDSPAEGHLQTKVLEINLLHAPQVADA
ILGNNMFSHYDKPTIGKLCEKSGLFQRALEHYDDLKDIKRVVVHTNVLPNDWLVAYFGQL
NVQQSVACLKELLSNNIQQNLQIVIQVATKYSDLIGPLTLIKIFEDYKCNEGAYYYLSSI
VNLTQDPDVVFKYIQCAAKMNQTKEIERVVRDNNVYNGEKVKNFLKEFKLEDQLPLIIVC
DRFNFVHDLILYLYKNKYFKFIEVYVQQVNPSNTPQVIAGLLDVDCDENIIKGLLISVLG
RIPIKELVSEVEKRNRLKILLPFLEKTLEGGSTDQEVFNTLAKIYIDSNNNPEKFLQDNT
NYDTLAVGKYCEKRDPYLAYICYSKGSNNDELINITNENKMYKYQARYLLAKSDFDLWNK
VLTEENTHRRQLVDQVIATGIPELDDPEPISITVKAFMENDLPHELIELLEKIILETSPF
NDNTSLQGLLILTAIKADNSRVMGYIEKLDKFDPEEIAPLCIDNQLYEEAFEVYDKFELR
SDAMKVLVDDIMSLDRGEQYAEKYDVSELWYQLGTAQLNGLRIPEAIDSYVKSKNPGNFE
QVIEISEHAGKEEELIPFLDMARETLRESSIDGALINCYANAGKLNEIEKFVSGPNVADM
ESIGDKLFEAKNYKAAKILYSNVSKYSKLATTLVYLKDYQGAVDCARKASNTSVWKQVNY
ACIENKEFRLAQICGLNLIIDAEELPELVKLYEKNGYFNELFALFESGLGLERAHMGMFT
ELAILYTKYSPEKVMEHLKLFWSRINIPKVLTACEEAHLYPELIFLYCHYEEWDNAALTM
IDKSEVAFDHSSFKEIVVKASNLEIYYKAINFYINENPSLLVDLLSVLTPKLDLPRVVRM
FVKSDNLPLIKPFLISVLDKNNSVVNGAYHDLLIEEEDYKSLRSTIENESNNRFNSLDLA
ERLENHDLIFFRQISATLYTKNKKFIKSISILKNDKLWADLIKTAAVSKSTKIAHELLDY
FVETGNRECFVALLYTCYDTIEYDYVLELSWLHELGNFIKPYEISVTYENQKKLDEVYND
LQKRREAEKQDEENPGMGQPLMITSGPAMNQSITGLGYQPTGAGFGNAF
NT seq 5010 nt NT seq  +upstreamnt  +downstreamnt
atgtctaatgatatccctattgatttcacggagttagctctgttaactgaattgggtatc
caacaaagttcacttgattttagatctacgacgcttgaatcggatcactacgtctgtgtg
agagaacaaggactgctgggaaatacggttgctatcattgatttgaaaaacaacaatgcc
gttaccagaaagaatatgagtgctgatagtgcaattttgcatccaggacagcttgttata
tccttgcgggccaatggtactacgttacagatcttcaatttgggtaccaaacaaagattg
aagtcattcaccatggaccaagcggttgtttactggaaatggttagacaatgagaacttg
ggtcttgtcacggcgaatagtatctatacgtggtctatatttgatggcagtaatgacggt
ccagttaaattgaccgatagacatcatacattaaacaattgccaaatcataaacttcgtt
gctgaaccgcaattgaactggtttgccgtgactggtatagctcaggaagaaggacgtata
gccggtcatatccaattattctccaagtcacgtaatgtgtctcaagctattgagggtcat
gtttgtaaatttggacaagtcaagttgaacggtgctttacatcctactaaagttttctgt
gtgggtaacaaaaatgcgcaaggtcaaggtaatttacatattattgaaattgatcacgta
gaaggtaatccagacttctccaaaaaatcagttgacatttttttccctcctgatgccgcc
aatgatttcccaattagtttgcaagcttctgacaaatacggtattgtctacattttaacg
aagtatggttttattcatttatatgatatggaaacaggttccaatttatttgttaataga
atcactgcggacccagttttcactgctgctccttataacgatggtaccggtattataacg
attaacaaatctggtcaagttttgagcgtcgaaatttcccagtctaaaattattccatat
gttttagaaaagttgtctaatgtcccattggcattagctctctcctctcgtggtgggttc
ccaggggctgaaaacttattcagtcaacaattccagaattatttaaaccaaggtgattat
actaatgcggccaaagttgctgcatcttctgagcaattgcgtactcaagatactatcaat
aagttgaagcatattactcctcaacctggacaaatttcaccaattttgcaatatttttcc
actttattggacagaggcacattgaataagtacgaatctattgagttagctaagccagtg
ttgcaacaagatcgtaaaccattatttgaaaaatggttgaaagaagataagttgacatct
tcagaggaattgggtgatattgttaaatcttataatgatgcaggtcttgcattagcggtc
tatattagagcaaatgttaatattaaggtcgtctcttgtttagctgaattaggccaattt
gacaagattatgccatactgtgaaaaggttggttacaagcctgactatacaaatttgata
caaaatttggtcagagttaatcctgataaagcaagcgaattcgcaacatcattattggct
tcctcagacactgatttgaaaattgaaaatattgctgatttatttttttcgcagaactat
attcaacaaggtaccgctttcttattagatgctttgaagaatgattctccagctgaggga
catttacaaaccaaggttttagaaattaacttgttacatgcaccacaggttgccgatgct
atcttaggtaacaatatgtttagtcattatgataagccaacaattggtaagttatgtgaa
aagtctggtttattccaaagggctttagaacattatgatgatttgaaagacattaagaga
gttgttgtccatactaatgtcttaccaaatgattggttagtcgcttattttggtcaatta
aatgttcagcagtccgttgcatgtttgaaagaattattaagtaacaatattcaacaaaat
cttcaaattgttattcaagttgctactaagtattccgatttaattggaccattgactttg
attaaaatttttgaagattataaatgtaacgagggtgcatactactatttatcttctatt
gtcaacttaactcaagatcctgatgttgttttcaaatatatacaatgcgctgctaaaatg
aatcaaactaaggaaattgaaagagtcgtcagagataacaatgtttacaatggtgaaaag
gttaagaactttttgaaggaattcaagttggaagatcaattgcctttaattattgtttgt
gacagatttaattttgttcacgacttgatcttatacttgtataagaacaagtactttaaa
ttcattgaggtttatgttcaacaagttaacccatccaatacgccacaagtaattgcaggt
ttattagatgtagactgtgatgaaaatattatcaaaggcttattaatatctgttttagga
cgcattcctatcaaggaattagtttctgaagttgagaagagaaacagactcaagatatta
ttgcctttcttagaaaagacattagaaggtggttctactgatcaagaagtattcaataca
ttagctaagatttacattgattctaacaataatcctgaaaagttcttgcaagataacaca
aattatgatactctcgctgttggtaagtattgtgaaaagagagatccatacttagcatac
atttgttactccaagggtagcaataacgacgagttaattaatattacgaatgaaaataag
atgtataagtatcaagcaagatatttattagccaagtctgatttcgatttatggaataag
gtcttaacagaagaaaatacccatagaaggcaattagtcgatcaagttattgcaacaggt
attccagaattggatgatcctgaaccaatttcgattactgttaaagcatttatggaaaac
gacttgccgcatgaattaatcgagttgttggagaagattattttggaaacctcacctttc
aatgataacacttctttacaaggtttgttgattttaactgctattaaggctgataattcg
cgtgttatgggttacatcgaaaagttggataaatttgatcctgaagaaattgcccctttg
tgtattgacaaccagttatatgaagaagcgtttgaggtttatgataaattcgagttaagg
tctgatgcaatgaaggtattggtagatgatatcatgtctttagatagaggtgaacaatat
gccgaaaagtacgatgtatctgaattgtggtaccaattgggtactgctcaattaaatggt
ttacgtatccctgaagctattgactcttatgttaagtcaaagaacccaggcaattttgaa
caagttattgaaatttctgaacatgcaggtaaagaagaggaattgatcccgttcttggat
atggccagagaaactttgagagaaagttctattgatggtgctcttattaactgttacgct
aatgccggcaaattaaacgaaattgagaaattcgtaagtggaccaaatgttgcagatatg
gaatctattggtgataagttgtttgaagctaagaactataaagcggctaaaattttatat
tcaaatgtttccaagtattctaaattagctactactttagtttatttgaaggattaccaa
ggtgctgttgactgtgcaagaaaagcatctaacacaagtgtttggaagcaagttaactac
gcttgtattgaaaataaagaattcagattggcacaaatttgtggtttgaatttgattatt
gatgctgaagaacttcctgaattagtaaaactctacgaaaagaatggttatttcaatgaa
ttattcgctctttttgaaagtggtttaggtttagaaagagcccatatgggcatgttcacc
gaattggctatcttatacaccaaatatagtcctgaaaaggttatggaacatttgaagtta
ttctggtccagaatcaatattcctaaggttttaactgcttgtgaggaagctcatttatat
ccagaattgattttcttgtactgccattatgaagaatgggacaatgctgcattgactatg
attgataagtcggaggtagcatttgaccattcctctttcaaggaaattgttgtcaaagca
tcgaacttggaaatttattacaaggcaattaacttttacataaatgagaacccttcgtta
ttagttgatttattatcagtattgacacctaagcttgatttaccaagggtagttagaatg
ttcgttaagtctgataatttaccattaatcaagcctttcttaatatctgtcttagataag
aacaactcagttgtcaatggtgcctatcatgatttattaattgaagaagaagactataaa
tctttgagatcaactatcgaaaatgaatccaataacagattcaactcattggatttagct
gagagattagaaaatcatgatcttattttcttcagacaaatttctgctacattatatacc
aagaataagaaatttatcaagtcaatttctatcttgaagaacgataagttgtgggccgat
ttgattaaaacagcagcagtttcaaaatcaaccaagatcgcccatgaattattagactat
tttgtcgaaacaggtaaccgtgaatgcttcgttgcattgttgtatacttgttacgatact
attgagtatgattatgtacttgaattatcatggttgcatgaattaggcaactttatcaag
ccatatgaaatctctgttacttacgagaaccaaaagaaacttgatgaagtatacaatgat
ttgcagaagagaagagaagctgaaaagcaagacgaagaaaaccctggtatgggacaacct
ttgatgattactagcggtccagctatgaatcaaagtattacaggattaggctatcaacca
actggagctggctttggtaatgctttttaa

DBGET integrated database retrieval system