KEGG   Debaryomyces hansenii: DEHA2E05654gHelp
Entry
DEHA2E05654g      CDS       T01026                                 

Definition
DEHA2E05654p
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
dha  Debaryomyces hansenii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:dha00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
E:463789..464583
Genome map
AA seq 264 aa AA seqDB search
MVHVLLLKNQTIPKDPYNDKLKASGYNPVFIPLLEHNHYDRHSTVEYLKSKEFSNIRNFI
ITSQRAVECFNECIQEINDENIKQSIFQKIGYTVGPATAKILSEAGFKTVKGGNDAGNGS
ILSKIIIDEIAPEEEIVFFTGKIRKDIIPKNLKLANINIMERVIYRTDLREDIGETFNKQ
LSLLDQTNNIEKKWIIFFSPQGTELIIEKLKQLDNLTSQFYIGSIGPTTEDYLVSRGITP
NIVSKKPEAASLFESMQNHEATYK
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggttcacgtattgttactaaagaaccagaccataccgaaagatccatataatgataaa
ttaaaggcgctgggatataatccggtgttcataccattgctcgaacacaatcactatgat
aggcattcaactgtagaatacttaaaaagtaaggaattttccaacatacgaaattttata
attacaagtcaaagggctgtcgagtgttttaatgaatgtatacaagaaatcaacgacgag
aacattaagcaaagtatattccaaaaaattggatatactgtggggcctgcgacggccaag
atattaagtgaagcgggattcaagactgtcaaaggtggtaacgatgccggcaatggactg
atattatccaagattataatcgacgagattgcacctgaagaggaaatagtattttttacc
ggcaaaattagaaaagatatcataccgaagaacttaaaattagccaatattaatattatg
gaaagagtaatttatagaacggatttgagggaagatattggtgaaaccttcaacaagcag
ctttcgctattagaccaaactaataatattgaaaagaaatggataatttttttcagtccc
caagggactgaattaataattgaaaaactaaaacagcttgataatttaactagtcaattt
tatattggttcaattggtccaacaactgaagactatttggttagcagaggtataactcct
aatattgtctcaaagaagcctgaggcagcatcattattcgaactgatgcaaaatcatgaa
gcgacttacaaataa

DBGET integrated database retrieval system