KEGG   Debaryomyces hansenii: DEHA2E05654gHelp
Entry
DEHA2E05654g      CDS       T01026                                 

Definition
(RefSeq) DEHA2E05654p
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
dha  Debaryomyces hansenii
Pathway
dha00860  Porphyrin and chlorophyll metabolism
dha01100  Metabolic pathways
dha01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dha00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    DEHA2E05654g
Enzymes [BR:dha01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     DEHA2E05654g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 RAP Antimicrobial17 DNA_pol_lambd_f NOG1 ArsR
Motif
Other DBs
NCBI-GeneID: 2901861
NCBI-ProteinID: XP_459567
UniProt: Q6BQF3
Position
E:463789..464583
Genome map
AA seq 264 aa AA seqDB search
MVHVLLLKNQTIPKDPYNDKLKASGYNPVFIPLLEHNHYDRHSTVEYLKSKEFSNIRNFI
ITSQRAVECFNECIQEINDENIKQSIFQKIGYTVGPATAKILSEAGFKTVKGGNDAGNGS
ILSKIIIDEIAPEEEIVFFTGKIRKDIIPKNLKLANINIMERVIYRTDLREDIGETFNKQ
LSLLDQTNNIEKKWIIFFSPQGTELIIEKLKQLDNLTSQFYIGSIGPTTEDYLVSRGITP
NIVSKKPEAASLFESMQNHEATYK
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggttcacgtattgttactaaagaaccagaccataccgaaagatccatataatgataaa
ttaaaggcgctgggatataatccggtgttcataccattgctcgaacacaatcactatgat
aggcattcaactgtagaatacttaaaaagtaaggaattttccaacatacgaaattttata
attacaagtcaaagggctgtcgagtgttttaatgaatgtatacaagaaatcaacgacgag
aacattaagcaaagtatattccaaaaaattggatatactgtggggcctgcgacggccaag
atattaagtgaagcgggattcaagactgtcaaaggtggtaacgatgccggcaatggactg
atattatccaagattataatcgacgagattgcacctgaagaggaaatagtattttttacc
ggcaaaattagaaaagatatcataccgaagaacttaaaattagccaatattaatattatg
gaaagagtaatttatagaacggatttgagggaagatattggtgaaaccttcaacaagcag
ctttcgctattagaccaaactaataatattgaaaagaaatggataatttttttcagtccc
caagggactgaattaataattgaaaaactaaaacagcttgataatttaactagtcaattt
tatattggttcaattggtccaacaactgaagactatttggttagcagaggtataactcct
aatattgtctcaaagaagcctgaggcagcatcattattcgaactgatgcaaaatcatgaa
gcgacttacaaataa

DBGET integrated database retrieval system