KEGG   Debaryomyces hansenii: DEHA2E05676gHelp
Entry
DEHA2E05676g      CDS       T01026                                 

Definition
(RefSeq) acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
dha  Debaryomyces hansenii
Pathway
dha00010  Glycolysis / Gluconeogenesis
dha00620  Pyruvate metabolism
dha00640  Propanoate metabolism
dha00680  Methane metabolism
dha01100  Metabolic pathways
dha01110  Biosynthesis of secondary metabolites
dha01130  Biosynthesis of antibiotics
dha01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dha00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DEHA2E05676g
   00620 Pyruvate metabolism
    DEHA2E05676g
   00640 Propanoate metabolism
    DEHA2E05676g
  Energy metabolism
   00680 Methane metabolism
    DEHA2E05676g
Enzymes [BR:dha01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     DEHA2E05676g
Lipid biosynthesis proteins [BR:dha01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   DEHA2E05676g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N T4_deiodinase
Motif
Other DBs
NCBI-GeneID: 2901869
NCBI-ProteinID: XP_459568
UniProt: Q6BQF2
Position
E:complement(464866..466881)
Genome map
AA seq 671 aa AA seqDB search
MTPHSTHVTLDHEGIIQPPAEFKERSKSKPNLADFETYSKMYKESIENPSKFFGEQALEH
LSWDRPFDEARYPVSSEQDFADGDIASWFVNGQLNASYNAVDRWAIKNPNKPAIIYEADE
ENEGRIITYGQLLKDVCKLAQCLTKLGIRKGDSVAVYLPMIPEALVTLLAIVRIGAVHSV
VFAGFSSSSLKDRILDASSKIVITTDESKRGGKTIETKKIVDDALKNCPDVTNVLLFKRT
GNAHIPFTEGRDLWWHEEMAKYGPYFPPVPVNSEDPLFLLYTSGSTGKPKGIQHSTAGYL
LGAAMTSKYTFDVHEDDVLFTAGDVGWITGHTYVVYGPLLCGATTVVFEGTPAHPNYSRY
WEIVDKYQVTQFYVAPTALRLLKRAGTKYIENYKLDSLRVLGSVGEPIAAEIWHWYNDNI
GRRKCHIVDTYWQTESGSHMLAPLAGITPTKPGSASLPCFGIDAKILDPVSGKELKENDV
EGVLCVKSCWPSISRGIYNDYARFIETYLKPYPNHYFSGDGAARDVDGFYWILGRVDDVV
NVSGHRLSTAEIEAALILHESVAECAVVGYADELTGQAVAAYVSLKSNVSEDLEVIKKEL
ILTVRKEIGPFATPKTILLVDDLPKTRSGKIMRRILRKVLAGEEDQLGDISTLSNPGVVA
QIIDVVKATRK
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atgacaccacactctacacacgtaacgttggaccatgagggtattatccaacccccagcg
gaatttaaggaaagatcgaagtccaaacccaacttggcagactttgagacctatagcaag
atgtacaaggaatcgattgagaaccccagcaaattttttggcgaacaagcgttggaacac
ttgagttgggaccgtccttttgacgaagccagataccccgtgagtagcgagcaggacttt
gcagacggggacattgcgtcgtggtttgtgaacgggcaattgaacgcttcgtataacgca
gttgacagatgggccatcaagaatcctaacaagccggcgataatctacgaggcagacgag
gaaaacgaaggtcgtattatcacgtacggccagttgttgaaggacgtgtgtaagttggca
caatgcttgacgaaattgggcatcagaaagggagattctgtggcagtatacttgccaatg
atccctgaggcgttagtgactttgttagcgattgtgagaattggggccgtccattcggtt
gtattcgccgggttttcatctagctcgttgaaggaccgtatcttggacgccagctcgaag
attgttatcaccactgatgagtcgaagagaggtggtaagaccattgagaccaagaagatt
gtggatgatgcgttgaagaactgtcctgacgtgacaaacgtcttgcttttcaagagaacc
ggcaacgcccatattccgttcaccgaaggcagggacttgtggtggcacgaggaaatggcc
aagtacggaccatacttcccaccggtaccagtcaactcggaagacccattatttttattg
tacacctcgggttcgacaggtaagccgaagggtatccagcactcgaccgcggggtacttg
ttgggggctgccatgacgtccaagtacacgttcgacgtgcacgaagacgacgtgttattt
accgcaggagatgtgggttggattactggacacacatatgtggtatacggtccgttatta
tgtggggccaccaccgtggtgtttgaaggtaccccagcccaccctaactactcgagatac
tgggaaattgtcgacaagtatcaggtcacccagttctacgttgctcctactgctttgaga
ttattaaagagagccggcaccaagtatatagaaaactataagttggattccttgagagtt
ttaggttctgttggtgaaccaattgcagccgaaatctggcactggtataacgacaacatt
ggtagacgcaagtgtcacattgttgatacctactggcaaacagaatcggggtcacacatg
ttagcgccattagccggtattactccaactaaaccaggctctgcctcgttaccatgtttt
ggtattgatgcgaaaatcttggacccagttagtggtaaggaattgaaggaaaatgatgtc
gagggggtcctttgtgtcaaatcgtgctggccatcaattagtagaggtatttacaacgac
tatgccagatttattgaaacttacttgaagccatacccaaatcattatttctcaggtgat
ggggctgcaagagacgttgacggattctactggattttaggtagagtcgacgatgttgtt
aatgtctccggtcacaggttgtctacggcggaaattgaagctgccttgatcttacatgaa
tctgttgctgaatgtgcagttgttgggtacgcagacgagttgacgggtcaagcagttgcc
gcttatgtttcattgaaatctaacgtatctgaagacctagaagtgatcaagaaagaattg
atcctaactgttcgtaaggaaatcggtccttttgcaactccaaagacaattttgttggta
gatgatttacctaagactagatcaggtaagatcatgagaagaattttgagaaaagttttg
gctggtgaagaagaccaattgggtgatatttcaacattatcgaatcctggtgttgttgct
caaatcattgatgtagtcaaggctactcgtaagtaa

DBGET integrated database retrieval system