KEGG   Debaryomyces hansenii: DEHA2E05676gHelp
Entry
DEHA2E05676g      CDS       T01026                                 

Definition
acetate--CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
dha  Debaryomyces hansenii
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dha00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DEHA2E05676g
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DEHA2E05676g
   00620 Pyruvate metabolism
    DEHA2E05676g
   00640 Propanoate metabolism
    DEHA2E05676g
  Energy metabolism
   00680 Methane metabolism
    DEHA2E05676g
Enzymes [BR:dha01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     DEHA2E05676g
Lipid biosynthesis proteins [BR:dha01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   DEHA2E05676g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
E:complement(464866..466881)
Genome map
AA seq 671 aa AA seqDB search
MTPHSTHVTLDHEGIIQPPAEFKERSKSKPNLADFETYSKMYKESIENPSKFFGEQALEH
LSWDRPFDEARYPVSSEQDFADGDIASWFVNGQLNASYNAVDRWAIKNPNKPAIIYEADE
ENEGRIITYGQLLKDVCKLAQCLTKLGIRKGDSVAVYLPMIPEALVTLLAIVRIGAVHSV
VFAGFSSSSLKDRILDASSKIVITTDESKRGGKTIETKKIVDDALKNCPDVTNVLLFKRT
GNAHIPFTEGRDLWWHEEMAKYGPYFPPVPVNSEDPLFLLYTSGSTGKPKGIQHSTAGYL
LGAAMTSKYTFDVHEDDVLFTAGDVGWITGHTYVVYGPLLCGATTVVFEGTPAHPNYSRY
WEIVDKYQVTQFYVAPTALRLLKRAGTKYIENYKLDSLRVLGSVGEPIAAEIWHWYNDNI
GRRKCHIVDTYWQTESGSHMLAPLAGITPTKPGSASLPCFGIDAKILDPVSGKELKENDV
EGVLCVKSCWPSISRGIYNDYARFIETYLKPYPNHYFSGDGAARDVDGFYWILGRVDDVV
NVSGHRLSTAEIEAALILHESVAECAVVGYADELTGQAVAAYVSLKSNVSEDLEVIKKEL
ILTVRKEIGPFATPKTILLVDDLPKTRSGKIMRRILRKVLAGEEDQLGDISTLSNPGVVA
QIIDVVKATRK
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atgacaccacactctacacacgtaacgttggaccatgagggtattatccaacccccagcg
gaatttaaggaaagatcgaagtccaaacccaacttggcagactttgagacctatagcaag
atgtacaaggaatcgattgagaaccccagcaaattttttggcgaacaagcgttggaacac
ttgagttgggaccgtccttttgacgaagccagataccccgtgagtagcgagcaggacttt
gcagacggggacattgcgtcgtggtttgtgaacgggcaattgaacgcttcgtataacgca
gttgacagatgggccatcaagaatcctaacaagccggcgataatctacgaggcagacgag
gaaaacgaaggtcgtattatcacgtacggccagttgttgaaggacgtgtgtaagttggca
caatgcttgacgaaattgggcatcagaaagggagattctgtggcagtatacttgccaatg
atccctgaggcgttagtgactttgttagcgattgtgagaattggggccgtccattcggtt
gtattcgccgggttttcatctagctcgttgaaggaccgtatcttggacgccagctcgaag
attgttatcaccactgatgagtcgaagagaggtggtaagaccattgagaccaagaagatt
gtggatgatgcgttgaagaactgtcctgacgtgacaaacgtcttgcttttcaagagaacc
ggcaacgcccatattccgttcaccgaaggcagggacttgtggtggcacgaggaaatggcc
aagtacggaccatacttcccaccggtaccagtcaactcggaagacccattatttttattg
tacacctcgggttcgacaggtaagccgaagggtatccagcactcgaccgcggggtacttg
ttgggggctgccatgacgtccaagtacacgttcgacgtgcacgaagacgacgtgttattt
accgcaggagatgtgggttggattactggacacacatatgtggtatacggtccgttatta
tgtggggccaccaccgtggtgtttgaaggtaccccagcccaccctaactactcgagatac
tgggaaattgtcgacaagtatcaggtcacccagttctacgttgctcctactgctttgaga
ttattaaagagagccggcaccaagtatatagaaaactataagttggattccttgagagtt
ttaggttctgttggtgaaccaattgcagccgaaatctggcactggtataacgacaacatt
ggtagacgcaagtgtcacattgttgatacctactggcaaacagaatcggggtcacacatg
ttagcgccattagccggtattactccaactaaaccaggctctgcctcgttaccatgtttt
ggtattgatgcgaaaatcttggacccagttagtggtaaggaattgaaggaaaatgatgtc
gagggggtcctttgtgtcaaatcgtgctggccatcaattagtagaggtatttacaacgac
tatgccagatttattgaaacttacttgaagccatacccaaatcattatttctcaggtgat
ggggctgcaagagacgttgacggattctactggattttaggtagagtcgacgatgttgtt
aatgtctccggtcacaggttgtctacggcggaaattgaagctgccttgatcttacatgaa
tctgttgctgaatgtgcagttgttgggtacgcagacgagttgacgggtcaagcagttgcc
gcttatgtttcattgaaatctaacgtatctgaagacctagaagtgatcaagaaagaattg
atcctaactgttcgtaaggaaatcggtccttttgcaactccaaagacaattttgttggta
gatgatttacctaagactagatcaggtaagatcatgagaagaattttgagaaaagttttg
gctggtgaagaagaccaattgggtgatatttcaacattatcgaatcctggtgttgttgct
caaatcattgatgtagtcaaggctactcgtaagtaa

DBGET integrated database retrieval system