KEGG   Debaryomyces hansenii: DEHA2E06556gHelp
Entry
DEHA2E06556g      CDS       T01026                                 

Definition
DEHA2E06556p
Orthology
K00844  
hexokinase [EC:2.7.1.1]
Organism
dha  Debaryomyces hansenii
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Overview; Carbon metabolism [PATH:dha01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dha00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:dha00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:dha00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:dha00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:dha00520]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
E:complement(524381..525802)
Genome map
AA seq 473 aa AA seqDB search
MLNLKLQTAVDDIVNQFTVTEEFLHDATKEFTKSMDTGLQNTASKREYMPMIPTYVTGIP
TGKEKGLFLAADLGGTNFRVCSVNLHGDHTHELKQSKYSIPLDLMKNSTADSLFSFLAKK
VETFLKDNHDDLEADEQLKLGFTFSFPINQTALNRGTLIRWTKGFDLPDCVDKDVVELLQ
SNIDLLGCKVNVVALANDTVGTLLSRAYSNNPEKTNANTIVGAIFGTGTNGAYFETLDNI
PKLKSTNIPEGAKGMVINTEWGSFDNTLKILPKTKYDEIVDSETANKGFHLFEKRISGMF
MGEILRVCLIDLFQRDLIFVDLYKSRGGSLPHRLSEEWLLSSEVLSYLQIDDSTDLKMSE
LILENELRLPTTKEERIVIQKLTQAIAHRAAYLSAIPVAAILNRVKGQFSNDNRDFEFGC
DGSVVEFYPGFQASILEALEIINPLEGEKKKVHLKIAKDGSGVGAALCASTAK
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgttaaacttaaaattacagacagcagttgacgatatcgtgaaccaattcaccgttact
gaagaatttcttcacgatgcgactaaggaatttactaaatcaatggacactggtttacaa
aacactgcgtcgaaaagagaatacatgccaatgatcccaacgtatgtcactggtattcct
actggtaaggaaaaaggcttatttttagcagcagatttaggtggtactaattttagagtc
tgttctgtcaatcttcatggagaccacactcatgaattaaagcaatcaaaatacagtatc
ccattggatttgatgaagaactctactgccgatagtttattctctttcttagccaaaaag
gttgaaacatttttgaaggataatcatgatgacctagaagcagatgagcaattaaaatta
ggctttactttctctttccctatcaaccagactgctttaaataggggcactttaattcgt
tggacaaagggattcgatttaccagattgtgttgacaaggacgttgttgagttattacaa
tccaacattgacttgttaggatgtaaagtcaatgtggtagcattagccaatgatactgtt
ggtacattattatcaagagcctattccaataaccctgagaaaactaacgctaacactatt
gtgggtgctatttttggtactggtactaatggagcatattttgaaacccttgataatatt
cctaaattaaaatctactaatattccagaaggtgccaaaggtatggtaattaatactgaa
tggggttcgttcgataacactctaaaaatattaccaaaaactaaatatgatgaaattgtc
gattcagaaactgctaataaaggctttcatttatttgaaaaaagaattagtggaatgttt
atgggagaaattttacgtgtttgtttgattgatttatttcaacgtgaccttatctttgtt
gatttatataaatctagaggtggttcattacctcacagattatctgaagaatggttatta
tcttctgaggttttatcttacttgcagattgatgattcaactgacttaaaaatgtctgaa
ttaatattagagaacgaattaagattgcctactactaaagaagaaaggatagttattcag
aaattgactcaagctattgcgcatagagctgcttatctttcggctattcctgttgctgct
atactcaatcgtgtcaagggacaattctccaacgataatagggactttgaattcggttgt
gacggatctgttgtagaattttatccgggattccaggcttctattttagaagcattagaa
ataatcaatcctttagagggagaaaagaaaaaggtccacttaaaaattgccaaagatggc
agtggagttggagctgcgttatgtgccagcacagcaaaataa

DBGET integrated database retrieval system