KEGG   Debaryomyces hansenii: DEHA2E06556gHelp
Entry
DEHA2E06556g      CDS       T01026                                 

Definition
DEHA2E06556p
Orthology
K00844  
hexokinase [EC:2.7.1.1]
Organism
dha  Debaryomyces hansenii
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dha00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DEHA2E06556g
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DEHA2E06556g
   00051 Fructose and mannose metabolism
    DEHA2E06556g
   00052 Galactose metabolism
    DEHA2E06556g
   00500 Starch and sucrose metabolism
    DEHA2E06556g
   00520 Amino sugar and nucleotide sugar metabolism
    DEHA2E06556g
  Biosynthesis of other secondary metabolites
   00524 Butirosin and neomycin biosynthesis
    DEHA2E06556g
Enzymes [BR:dha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     DEHA2E06556g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
E:complement(524381..525802)
Genome map
AA seq 473 aa AA seqDB search
MLNLKLQTAVDDIVNQFTVTEEFLHDATKEFTKSMDTGLQNTASKREYMPMIPTYVTGIP
TGKEKGLFLAADLGGTNFRVCSVNLHGDHTHELKQSKYSIPLDLMKNSTADSLFSFLAKK
VETFLKDNHDDLEADEQLKLGFTFSFPINQTALNRGTLIRWTKGFDLPDCVDKDVVELLQ
SNIDLLGCKVNVVALANDTVGTLLSRAYSNNPEKTNANTIVGAIFGTGTNGAYFETLDNI
PKLKSTNIPEGAKGMVINTEWGSFDNTLKILPKTKYDEIVDSETANKGFHLFEKRISGMF
MGEILRVCLIDLFQRDLIFVDLYKSRGGSLPHRLSEEWLLSSEVLSYLQIDDSTDLKMSE
LILENELRLPTTKEERIVIQKLTQAIAHRAAYLSAIPVAAILNRVKGQFSNDNRDFEFGC
DGSVVEFYPGFQASILEALEIINPLEGEKKKVHLKIAKDGSGVGAALCASTAK
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgttaaacttaaaattacagacagcagttgacgatatcgtgaaccaattcaccgttact
gaagaatttcttcacgatgcgactaaggaatttactaaatcaatggacactggtttacaa
aacactgcgtcgaaaagagaatacatgccaatgatcccaacgtatgtcactggtattcct
actggtaaggaaaaaggcttatttttagcagcagatttaggtggtactaattttagagtc
tgttctgtcaatcttcatggagaccacactcatgaattaaagcaatcaaaatacagtatc
ccattggatttgatgaagaactctactgccgatagtttattctctttcttagccaaaaag
gttgaaacatttttgaaggataatcatgatgacctagaagcagatgagcaattaaaatta
ggctttactttctctttccctatcaaccagactgctttaaataggggcactttaattcgt
tggacaaagggattcgatttaccagattgtgttgacaaggacgttgttgagttattacaa
tccaacattgacttgttaggatgtaaagtcaatgtggtagcattagccaatgatactgtt
ggtacattattatcaagagcctattccaataaccctgagaaaactaacgctaacactatt
gtgggtgctatttttggtactggtactaatggagcatattttgaaacccttgataatatt
cctaaattaaaatctactaatattccagaaggtgccaaaggtatggtaattaatactgaa
tggggttcgttcgataacactctaaaaatattaccaaaaactaaatatgatgaaattgtc
gattcagaaactgctaataaaggctttcatttatttgaaaaaagaattagtggaatgttt
atgggagaaattttacgtgtttgtttgattgatttatttcaacgtgaccttatctttgtt
gatttatataaatctagaggtggttcattacctcacagattatctgaagaatggttatta
tcttctgaggttttatcttacttgcagattgatgattcaactgacttaaaaatgtctgaa
ttaatattagagaacgaattaagattgcctactactaaagaagaaaggatagttattcag
aaattgactcaagctattgcgcatagagctgcttatctttcggctattcctgttgctgct
atactcaatcgtgtcaagggacaattctccaacgataatagggactttgaattcggttgt
gacggatctgttgtagaattttatccgggattccaggcttctattttagaagcattagaa
ataatcaatcctttagagggagaaaagaaaaaggtccacttaaaaattgccaaagatggc
agtggagttggagctgcgttatgtgccagcacagcaaaataa

DBGET integrated database retrieval system