KEGG   Debaryomyces hansenii: DEHA2E07810gHelp
Entry
DEHA2E07810g      CDS       T01026                                 

Definition
DEHA2E07810p
Orthology
K07204  
regulatory associated protein of mTOR
Organism
dha  Debaryomyces hansenii
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
E:618101..622396
Genome map
AA seq 1431 aa AA seqDB search
MRHGFDEDYNSENFLTLLANSFYIYFDDKRHNTNGNPITDEMKSSSEYIKNYQPITDWKV
MRERQKTISAVLVLCLNLGVDPPDVMKTYPCAKYEAWCDPSLFSDTKKAIETIGKNLQSQ
YETLSLRTRYKQSLDPCVEDVKRFCNTLRRNAKDERILFHYNGHGVPQPTPSGEIWVFNR
GYTQYIPISLYDLQTWLGAPVIFVYDCNSAGNIVHNFKKFAQKRIDDDNEGNHDLSAPSP
TSAYLDCIQLAACKSNELLPMSPDLPADLFTCCLTCPIDISIKWFIMQSPLKKNYYNLLP
RNATGTVIIPGKLTDRRTPLGELNWIFTAITDTIAWASLSRPIFKRLFRQDLMVAALFRN
FLLAKRIMPHLNCNPISDPPLPDTVRFHRMWDSWDLAIDQVFAQLLKNSNPDPQSGASLN
QSQLVKQQPFPQSLLDKTGTNSQSKSNSSTQASITTSASTGNLNSTVSAPPNLANYQHST
FFEQQLTAFEIWLKYAGSSTKEPPEQLPIVLQVLLSQVHRLRALILLSKFLDLGPWAVYL
SLSIGIFPYVLKLLQSPAQELKPVLIFIWARIMAIDYKSTQQELCKDKGYNYFYIILNSN
PLNQINGGDNINASGANILINDDHKAMSAFILTLFIKDFKNGQRLCFSIELINNCLKFLS
TSENPLLRQWCCLLLSQLWMNYPDGKWIIYKDGYLNKFLMMINDPIPEVRTSIVLALTNF
LSDSADFQPPQQSHQQQQRSHMNVGPDLRRDELRQQDLRLANTILSLLGDGSSMVRKEIV
YFINKFISIYSKFFLVLAFNQLEEEIVLIDNSNYLSEFRKKSPAYGSIFSSLWKSLLILS
EDPHLEVKQMAEVLIDSVMVKLNESDLGPLVKEMQDYLLSKSTININETFKPSKPIVNRQ
LASLNGSHPNRRQVSSGPTVERKNNMLTINGSSIKTRSASTNDMDRNTIASDDSDAESIS
SKLKNLSLFKLIKSFQMNDDNELKHFTRILNSGPIASSYGVEYKPKTPRFRPRKLSIEPK
LPAESGFFEYSCEYFQEPQMSKNEIDEPGSEEYVKRLWRRNRNEAIIQETQSQKSVAIRG
DWNKSLTIMNNKSQPKLIKFTQFEKILVASDEKDNVSVWDWEMNKMVGKFSNCNPFGTKI
TDIKFLNEDDLPLLLTGSSDGVIKIYKNFHTANNIGERNVELVSSWRALTDLLLTSKSSG
LISEWQQSRGSLLVSGDVKIIRVWDAPRELCLVDIPARSSSSITSLTSDQVAGNIFIAGF
DDGSLRVYDRRLDSRESMVKTWHSKTRNANNPDQAYKNITGHGSIRNVHMQRGGYRELVS
GSSDGFVNLWDIRLNDPVLTYTNSPEKSMRCIDAHEHAPIITTGSKSVKLWTTSGDLLTT
LKNPHDTYLSNRTSSYLSSTTFHPHRMMMATNYNQDGHINVYTCNDVIQEY
NT seq 4296 nt NT seq  +upstreamnt  +downstreamnt
atgagacacgggtttgatgaagactacaattcagaaaactttttgacgttgttggctaat
tcgttctatatttatttcgatgataagagacataatactaatgggaacccaatcacagac
gagatgaaactgtcgagcgaatatatcaagaattaccaaccgattaccgattggaaagtg
atgagggagcgacagaaaacaataagcgcagtgcttgtgttgtgtttgaatttgggagtt
gatccaccggatgtaatgaagacatacccgtgtgcaaagtacgaggcatggtgtgatcca
tcgcttttctcggacaccaagaaggcaattgaaaccatcggaaagaatttgcaatctcag
tatgagacattgtcgttgagaactcgttacaaacagtcgttagacccatgtgtggaagac
gtgaaacgattctgtaatactctcagacgaaatgcgaaggatgaaaggattttgtttcat
tacaacgggcatggagtccctcagccgacccctagtggtgagatttgggtgttcaacaga
ggctacacacaatacattccaatatctttatacgatttgcaaacctggttgggggcgcct
gtcatattcgtgtatgattgtaacagtgcaggtaatattgttcataatttcaagaaattt
gcacagaaaaggattgatgatgataatgaaggtaatcatgacctaagtgcgccatctcca
acttcagcatatttagattgcattcaattggcggcttgtaaaagcaacgaactcttgcca
atgagtccagatttaccagcggatttatttacatgttgtttgacatgtcctattgatata
agtattaaatggttcataatgcaatctccactaaagaaaaactattacaatttattacct
cgaaatgctacaggtacagttatcattcctggaaaattaactgacaggagaaccccgtta
ggggaattaaattggatatttacagctatcactgatacaatagcgtgggcatccttatcg
agacctatatttaagagattgtttaggcaggatttaatggtcgcagcattgtttaggaat
ttcctattagctaaaagaataatgcctcatcttaattgtaatcctataagtgatccaccc
ttgcctgatacggtcagatttcaccgtatgtgggattcctgggatttggctatagaccaa
gtatttgcccaattacttaagaacagtaatccggaccctcaatcgggtgcctcgctaaat
caatctcaattggttaaacaacaaccatttcctcaatcactattagacaaaacaggaaca
aattctcaatctaagtccaattcttcaacacaagcatccattactacttcagctagcaca
ggcaatttaaattcaacagtatcagctcctcctaatttggcaaattatcaacattcaaca
tttttcgaacaacagttaactgcatttgaaatatggttgaagtatgcgggatcatctaca
aaggagccaccggagcaattgccaatagtcttgcaggttttgctttcacaggttcacaga
ttaagggctttgatattattgtctaagtttttagatttgggtccatgggcggtttatctt
tctttatcaattggtattttcccttacgtattaaagttattgcaaagtccagctcaagaa
ttgaaaccggttttaatttttatttgggcaaggattatggcaatcgactataaaagcacg
cagcaagagttatgtaaggataaaggttacaattatttctacataattttaaattcaaat
ccattgaatcaaattaatggaggtgataatattaatgcatctggcgctaatatcttaatt
aatgatgatcacaaagcgatgagtgcatttattttaacattattcattaaggactttaaa
aatggtcaaaggttatgtttttcgattgagttgattaataattgtttgaagtttctctca
actagcgaaaaccccttattaagacaatggtgttgcttattactttcccaactttggatg
aattaccccgatggaaagtggataatttataaggatggctatttaaacaagtttttgatg
atgatcaatgatccaataccagaagtcaggacttcaattgttttagctttgactaatttc
ttaagtgactcagcagactttcaaccgccacagcaatcacatcagcaacagcaacgttct
catatgaatgttgggccagatttaaggagagatgaattaagacaacaagacttgagactt
gcaaataccattttaagtttgcttggagatggatcttcaatggttagaaaagaaatcgtt
tatttcatcaataaattcattagtatttattcgaagttctttcttgttctagcattcaac
cagttagaggaagaaatcgttcttattgacaattctaattatttgagtgaattccgtaaa
aagtcgcccgcatatggttcgatctttagttcactttggaaatcattactaatcttatcg
gaagatccacatttggaagtcaaacaaatggcagaagttttaattgattcggttatggtt
aagctaaatgaaagcgatttaggtcctttggttaaagaaatgcaagactacttattgagc
aaatcaactattaatattaacgagacctttaaaccctcgaaaccaatcgtgaaccgtcaa
ttagcttctttaaatggttctcatccaaacaggcgtcaagtttcaagcgggccaacagta
gagcgaaaaaacaatatgttgactattaatggatcctcaattaaaacaaggtcagcttca
actaatgatatggatagaaatacaattgcgagtgatgattctgatgcagaatctatttct
tcaaagttgaagaatttatcactctttaaacttataaagtcatttcaaatgaatgacgat
aacgagttgaagcatttcactagaatcttgaactcaggccctattgcgagcagttatggt
gtagaatacaaacctaagactccccgtttcagacccagaaagttgtccatcgaaccgaaa
ttgcctgctgaatcaggttttttcgaatacagttgtgaatattttcaggaacctcaaatg
tctaaaaatgaaattgacgaacctggctcggaggaatacgttaaaagattatggagaagg
aatagaaacgaagctattatccaagagactcaatctcaaaagagtgtagcaatcagagga
gattggaataagagcttgactattatgaataataagtcgcaacctaagttaatcaaattt
actcaatttgaaaaaatattagttgctagtgatgagaaggataatgtgtccgtctgggac
tgggaaatgaataaaatggttggaaaattctccaattgtaatccatttgggacgaaaatt
actgatattaagtttctcaatgaagacgatttacctttattgttgacaggttcttctgat
ggggtcattaaaatctataaaaatttccacactgcaaataatataggtgaacggaatgtc
gaattagtttcatcttggagagccttgactgatttattgttaacttcaaaaagttctgga
ttaatttccgaatggcagcaatcgagagggtctctattagtcagtggtgatgttaagata
atcagagtatgggatgctcctagagagctatgtctagtagatattcctgcaagatcatcc
tcgtcaatcacttcgttgacctccgatcaagtagcaggaaatatttttattgccgggttc
gatgatggcagtttacgagtttatgacagaaggttagattcgagagaatctatggtaaag
acttggcactcaaaaactcggaacgcgaacaatccagaccaagcatacaaaaatatcact
ggccatggctcaataagaaatgttcatatgcaaagaggtggttacagagaattggttagc
ggatcttccgatggttttgtaaatttgtgggatatacgattaaacgacccagttttaacg
tataccaactcacctgaaaagtctatgagatgtatagatgcccatgaacatgctccaata
ataactactggttcaaaatctgttaaattatggactacatctggtgatttactaaccact
ttgaaaaatcctcatgacacatacttgtcaaacagaacgtcaagttatttgtcaagtacc
acttttcacccgcatagaatgatgatggctacaaattacaatcaagatggacacatcaat
gtgtacacatgcaatgacgttatacaggagtactag

DBGET integrated database retrieval system