KEGG   Debaryomyces hansenii: DEHA2E08228gHelp
Entry
DEHA2E08228g      CDS       T01026                                 

Definition
DEHA2E08228p
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
dha  Debaryomyces hansenii
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dha00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    DEHA2E08228g
Enzymes [BR:dha01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     DEHA2E08228g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
E:648490..649389
Genome map
AA seq 299 aa AA seqDB search
MSFTRQLTKNLTSFKVLAPFAAAVGSVGIAYQYSTSSIMNETGKTFTGNDEWIDLKLAKS
WDTTHNTKHFVFELANQDDVSGLINASCLLTKFVTPKGNNVIRPYTPISDVDGKGSIEFV
IKKYDGGKMSSHIHDLKPNDTLAFKGPVVKWKWEPNQYKSIALIGGGTGITPLYQLMHEI
TKNPEDKTKVNLFYGNLTEKDILIKKELDTIAEKHKDQVNVVYFLDKAPENWNGETGYIS
KEFLQSKLPGPGKDNKVFVCGPPGLYKALSGPKKSPTDQGEVEGALADLGYTKENVFKF
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgtcatttactcgtcaattaactaagaatttaactagttttaaggtattagcaccattc
gctgctgcggtgggaagcgtcggaatagcataccaatattcaacatcttctattatgaat
gaaacaggaaagactttcactggtaatgacgaatggattgacttgaagttagctaagagt
tgggataccactcataacactaaacattttgttttcgagttggccaaccaggatgatgtt
tccggattgatcaatgcttcgtgtttattaaccaagtttgttacaccaaagggtaacaat
gttatcagaccatacactccaatttctgatgttgatggtaagggttctattgaatttgtc
atcaagaagtacgatggaggtaagatgtctagccacatccatgacttgaagccaaacgac
actttggcattcaagggaccagttgtcaagtggaagtgggaaccaaatcaatacaagtcg
attgctttgatcggtggtggtaccggtatcactccattgtaccaattgatgcacgaaatt
accaagaaccctgaagacaagaccaaggtcaacttattctacggtaaccttaccgaaaaa
gatattttgattaagaaagaattagatactattgctgaaaagcacaaggaccaagtcaac
gttgtttatttcctcgacaaggctcctgaaaactggaacggcgaaaccggttacatttct
aaggaattcttacaatctaaattgccaggtccaggtaaggacaacaaggttttcgtctgt
ggtccaccgggcttgtacaaggctctttctggtcctaagaagtctccaactgaccaaggt
gaagttgaaggtgccttagctgacttaggttacaccaaggaaaatgtcttcaagttctag

DBGET integrated database retrieval system