KEGG   Debaryomyces hansenii: DEHA2E12892gHelp
Entry
DEHA2E12892g      CDS       T01026                                 

Definition
DEHA2E12892p
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
dha  Debaryomyces hansenii
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dha00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DEHA2E12892g
Enzymes [BR:dha01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     DEHA2E12892g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
E:1019164..1020072
Genome map
AA seq 302 aa AA seqDB search
MPVEETETEVILTLPNDPNTKVTILKYGATIISWENKGDEKLWLSKAAKLDGSKPVRGGV
PLVFPCFGKCNDESNPAYKLPQHGFARNSTWEFLGQTTESPVTIQFGLGPEQVDQDLYKL
WNDGLYDFTLILSITLGEDHLKTNIEVENTGDKDFKFNWLFHTYFKIPDITDIIVNNFTD
AKCYDQLIGETYEEKAPMISFTEEFDRIYKGIDTQKTFQMIELGKVLMNVQRENLPDSVV
WNPWIKKSEGLADFEPKDGYMNMLCIEPGHVAEFKNLKSGEKWSGAQILSTGGEIKVQTN
IY
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgccagtagaagaaacagaaacagaggtcattttgacacttccaaacgacccaaacact
aaagttaccattttaaagtacggtgctaccatcatttcgtgggagaataaaggagatgaa
aaattatggttatcaaaagcagcaaagcttgatggatccaagccagtaagaggaggtgtt
ccattagtattcccatgttttggaaaatgtaacgatgagagcaatccagcctataaatta
ccacaacatggatttgcaagaaattctacctgggaatttttgggacaaactactgaaagt
cctgtaaccattcaatttggattaggtccagaacaagttgaccaagatttatataaattg
tggaatgatgggttatacgactttacattgatcttgtcaattactttgggagaagatcat
ttaaaaacaaatatagaagtggagaatactggcgataaagattttaagttcaactggtta
ttccatacctacttcaaaatcccagatattacggacataatagttaacaattttaccgat
gctaaatgctacgatcagttaattggcgaaacatatgaagaaaaggctccaatgattagt
tttactgaagaatttgacagaatctataaaggtattgatacccagaagaccttccaaatg
atcgaattaggtaaggttttaatgaatgttcaaagagagaacttgcctgatagcgttgtt
tggaatccatggatcaaaaaatcagaaggtttggccgatttcgagccaaaggatggttac
atgaacatgttgtgcatagaaccaggccatgttgcagaattcaagaatttgaaatctggt
gaaaaatggagtggtgcacaaatattatctactggtggtgaaattaaagttcaaactaac
atttattaa

DBGET integrated database retrieval system