KEGG   Debaryomyces hansenii: DEHA2E13530gHelp
Entry
DEHA2E13530g      CDS       T01026                                 

Definition
DEHA2E13530p
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
dha  Debaryomyces hansenii
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:dha00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DEHA2E13530g
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    DEHA2E13530g
   00630 Glyoxylate and dicarboxylate metabolism
    DEHA2E13530g
Enzymes [BR:dha01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     DEHA2E13530g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
E:complement(1072347..1074002)
Genome map
AA seq 551 aa AA seqDB search
MSSPFPKTADKLKGVEILASIPDRAKHILNAEALALVATLHRAFQPTRKQLLANRKEQQA
KRDRGELPDFLPETEQIRNDPTWTGPPLARGLEDRRVEITGPVDRKMVINALNSGVATYM
ADFEDSLTPAWDNLIDGQVNLYDGVRKNISFEQNGKKYALNTDPKRHLPTLIVRPRGWHL
DEKHVRVDGEPVSGGIFDFAIYFYNNAKESVAQGFGPYFYLPKMEHHLEAKLWNDIFNHA
QDYIGMTRGTIRGSVLIETLPAAFQMDEIIYQLRQHIGGLNCGRWDYIFSYIKSLRNHPE
FILPERSQVTMSAPFMSSYVKLLVNTCHKRQVHALGGMAAQIPIKEDKARNQAALENVAK
DKLREVNAGCDSCWVAHPALVPVVLKVFNEHMKGPNQINVPPKVPYTPVTARDLLSPYVP
DAKITEQGIRTNIIIGLSYIEAWLRNIGCVPINYLMEDAATAEVSRTQIWQWVTHGSKTD
EGKTITKEYVGKLLKEESDKLSKNAKSGNKFSQALVYFKPECLAEKYSDFVTTLLYDDVT
TIGRPTAAEKL
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtctccatttccaaagaccgctgataagttaaaaggagttgaaattttggcatca
attccagacagagccaagcacattttaaatgctgaagctcttgcattagttgctacatta
caccgtgcattccaaccaaccagaaagcaattattggctaacagaaaggaacaacaggcc
aagagagacaggggagagttaccagactttttgccagaaactgagcagattagaaatgat
cctacctggaccggtccaccattagccagaggcttagaggacagaagagtcgagatcaca
ggaccagtggacagaaagatggttatcaacgcgttgaactctggtgttgccacatacatg
gctgattttgaagactctttgactccagcatgggacaatttgatcgatggacaagttaat
ctttatgacggtgtcagaaagaacatttcttttgaacaaaacggtaagaagtacgcattg
aacaccgacccaaagaggcaccttccaaccttgattgtcagaccaagaggatggcacttg
gatgaaaagcacgttcgcgttgatggtgaaccagtttccggtggtatttttgattttgcc
atctacttctacaacaacgccaaggaatctgttgctcaaggatttggtccatacttttac
ttgccaaagatggagcaccacttggaagccaagttatggaacgatatcttcaaccacgct
caagactatattggtatgaccagaggtactatcagaggttccgttttgattgaaacattg
ccagccgctttccaaatggacgaaatcatttaccaattgagacaacacattggtggtttg
aactgtggtagatgggattacattttctcatacattaagtcattgagaaatcacccagaa
tttatcttaccggaaagatcacaggtcactatgtctgctccattcatgtcttcttacgtc
aagttattagttaacacttgtcacaagagacaagtccatgctttaggtggtatggctgct
caaattccaatcaaggaagataaggcaagaaaccaagctgccttagaaaacgttgctaag
gataagttgagagaagttaatgccggttgtgactcctgttgggttgcacatccagctttg
gttcctgttgttttgaaggttttcaacgaacacatgaagggtcctaaccaaatcaatgta
ccaccaaaggtcccatacactcctgttaccgccagagacttattaagtccatacgttcca
gatgccaagatcactgaacaaggtatcagaactaacattatcattggtttatcttacatc
gaagcttggttaagaaacatcggttgtgttccaattaactacttgatggaagatgctgcc
actgctgaagtctccagaactcaaatctggcaatgggttactcacggctctaagaccgac
gaaggtaagaccattaccaaggaatatgttggtaaattattaaaagaagaatccgataaa
ttatccaagaacgctaaatcaggtaacaagttcagtcaagcattggtttatttcaagcca
gaatgtcttgccgaaaaatactctgatttcgttactactttgctttacgacgacgttact
actatcggcagaccaactgccgctgaaaaattataa

DBGET integrated database retrieval system