KEGG   Debaryomyces hansenii: DEHA2E18348gHelp
Entry
DEHA2E18348g      CDS       T01026                                 

Definition
DEHA2E18348p
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
dha  Debaryomyces hansenii
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:dha00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    DEHA2E18348g
Enzymes [BR:dha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     DEHA2E18348g
Protein kinases [BR:dha01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [Table]
   DEHA2E18348g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
E:1492705..1494216
Genome map
AA seq 503 aa AA seqDB search
MPQDTETMYSGRVVNKVYNQDFIIDRRFKIVKELGHGAYGIVCSAKYDDGSDNEDGSYVA
IKKITNIFSKKILCKRSLRELKLLQFFRGHKNITCLYDLDIIPNPITGEFNEIYLYEELM
ECDMHQIIRSGQHLTDSHYQSFIYQTLCGLKYIHSADVLHRDLKPGNLLVNADCELKICD
FGLARGFSECPEQNVGFMTEYVATRWYRAPEIMLSFTNYTKAIDIWSVGCILAELLGGKP
IFRGKDYVDQLNQILLILGTPKESTLTKIGSVRAQNYVRSLPFMRKVHYSELFPTANPLA
LDLLEKMLTLDPYERITVEEALNHPYLSVWHDPQDEPECQIKFDFKSFETVDDMKSMKNL
IIDEVKNFRDFVRKPLQEQQQIQLQMQIQQQEREKQKNDSMDLSTPINQQQFNEMLSSSS
NSNSNSNSNPETGVNTDTPKMTNDNDLQYYQSIPKPQELDEFTFSHNSKGLSPTDNNDNH
TDLFRLEEELGFGLDGAGMFNNI
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgccacaagatacagagacaatgtattctggacgtgttgtgaataaggtttataaccaa
gatttcatcattgatagaagattcaagatagtgaaagaattagggcatggggcttatgga
atcgtatgttcggccaagtatgacgatggatctgataatgaagatggaagctatgtagct
attaagaagatcaccaatattttcagcaagaaaatattgtgtaagagatctttgagagaa
ttgaaattgctacaattcttcagaggacacaagaatattacatgtctatatgatttggat
attattcctaatccaataaccggagaattcaacgaaatatatctttatgaagaattaatg
gaatgtgacatgcatcaaatcattagatcaggtcaacacttaacggattcgcattatcaa
tcattcatttatcagacattgtgtggtttaaagtatattcatagtgctgacgtcttgcat
cgtgatttaaaaccaggcaatttattagttaacgctgattgtgaattgaagatttgtgat
tttggattagcaagggggttcctggaatgtcctgagcagaatgttgggttcatgactgaa
tatgtagcaactaggtggtacagagctcctgagatcatgttgagttttacaaattatact
aaagcaattgatatctggtcagttggttgtatattggccgaattattaggagggaaacca
attttcagaggtaaggattatgttgatcaattgaatcaaattttacttattttaggaacc
ccgaaggaatcaacattaactaagattggatctgtcagagctcagaattatgtgagatcc
ttaccgtttatgcgaaaggttcattattctgaattgtttccaactgcaaatccgttggct
ctagatttattggaaaaaatgctcactttagatccgtatgaaagaattaccgttgaagaa
gcgttaaaccatccatatttatctgtttggcatgatccacaagatgaaccagagtgtcaa
ataaaatttgatttcaagtcgtttgaaactgtcgatgatatgaagtcaatgaaaaatctt
ataattgatgaggtcaagaattttagagattttgtcagaaaaccattacaagaacaacag
caaattcaactacaaatgcagatacagcaacaggaaagagagaaacaaaaaaatgattcc
atggatttatcaactccaataaatcagcaacaatttaatgaaatgttaagttcaagttct
aactctaactccaattcaaattcaaacccagagacgggggttaatacagacactccaaag
atgacgaatgataatgacttgcagtattatcaatctattccaaaaccacaggaacttgat
gaatttacattttcacataatagtaagggcttatctccgacagataataatgacaatcat
actgatttatttagattggaagaagaactagggtttggcttagatggtgctgggatgttc
aataatatttaa

DBGET integrated database retrieval system