KEGG   Debaryomyces hansenii: DEHA2E18546gHelp
Entry
DEHA2E18546g      CDS       T01026                                 

Definition
DEHA2E18546p
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
dha  Debaryomyces hansenii
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:dha00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:dha00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
E:1522688..1525822
Genome map
AA seq 1044 aa AA seqDB search
MSESSSQKFHAGQLLCGGFQGTNVTAQAYHLIVQHHVSAMILSKKNAVSVKQMTKLIRDL
QYIAYTQANYKYPLLFAIDEEGGMMNSLFDPNFLNQFPGAMAMAATGDADLVYKISKAIA
IELKHIGFSIILGPVLDVVTKLSHQLVGVRSFGTTVEDVTKYGKACARGLKDGGLITVGK
HFPGIGNASVDSLLELPMMADSLDQIKHFNSVPFAELIKEKLLDGISAAGCGVPTISPDE
THACLSPIVINQLLRQDLGFDGMVISECLEMDALYHSIGLGQGVILALYAGCDLVMVCHD
KTLQDEAVESIDKALANGNLDDEIISSCLRRIEKLQKKLPSWNELFPRGEDSAKEDELPL
FKDKYHEMWKQHQSLSQMAYRKSITLVRDYTGTLPITKIFESLPQSSIAEDNTNNILLLT
PLLNPIYPRSHGENGEPQLYTGEEVFQKFGDFLSSHSKNLKSKNPYSVLHTTYTANGLTA
LHESLIENSKAVIVLTSEASRNMYQIGIVKYISILCGANPSSFNNTASSHSQLAKPLIIV
ATSSPYDFFYNKSIGSAYLCCYDYTNNVLKELAGVLMGDIQAEGCIPGEKKFVGKSRKRK
SIDSQNTGEKHNQLKERRSSQPKRRWLVDEFDLKRDWAGLINIWKSNTDSSSNVDDLTVN
VSNNQSGEITYQDESFYKKMYQLLSTTANTQKHFVIRNSSLNILYGFVLTWVDDSQGVPL
DGDLTKSDNIQKKTGSIMYLLVDKSKRLQSIGKNLHARAIRYLTKEQKCTSLTLGCSFPL
LVLPKNSNLLTNNKVVSFMNNVGWDVSNDYSKKHIMVLYDLNNWSVPKKIFRELTIVGVR
FDVCTDPQKLMNLIHSSISQHDKSVKNSIRSGTRMREDKDNTKEVYIEAIKYLTNSPSYG
VKIIIALEPTNQNIIGSIILFTNKSQMSKFYPFLEECLKDSKTLENSNSQDPLIGGIMAP
VIDPSYSNLTEIINFGLICSAITFAKTGFNDNDQNQMNKCVMMGINDDNLGNISGIKEIG
FEEWKYFYDFYDAKNDVEKSFLGE
NT seq 3135 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaatcttcttcacagaaatttcatgctggtcagcttctatgtgggggattccaa
ggaacgaatgttacggctcaagcatatcacttgattgttcaacatcatgtctcagcgatg
atactctcgaagaaaaatgctgtgtctgtaaagcaaatgacaaaattaataagagacttg
cagtacattgcgtacactcaggctaattataaatatccacttttatttgcaattgatgaa
gagggtggtatgatgaactcattgtttgatccgaacttcctaaaccaattccccggtgca
atggctatggcagcaacaggtgacgctgatttagtttacaaaatcctgaaggcgatagct
attgaattaaaacatattggattcctgataattttgggacctgtgttggatgtagtgaca
aaactatctcatcaattagttggggtaagaagtttcggtaccaccgttgaggatgtcact
aaatatggtaaggcttgtgctaggggcttgaaagatggaggtttgatcactgttggcaag
cattttccaggaatcggaaatgcgagtgttgattctttattagaattacctatgatggca
gactcattggaccaaattaaacattttaacagtgttccctttgctgaattaattaaagag
aagttactagatggtatcagtgctgcaggttgtggggttcccactataagtcccgatgaa
acacatgcttgtttgtcgccaattgtaataaaccaattattgagacaagacttgggattt
gacggtatggtaataagtgaatgtttggaaatggatgcgctataccattcaattggactt
ggtcaaggtgttatcttagctctctatgctggatgtgatttagtgatggtctgtcatgat
aaaactttacaagatgaagcggtcgaatcgatagataaagcgttagccaatggtaacctt
gatgatgaaattatatcatcatgcttgagaagaattgagaaactccaaaaaaaattacct
agctggaatgagttgtttccaaggggagaagactctgctaaagaagatgaattgccattg
tttaaggacaaatatcatgaaatgtggaaacagcatcaatctttatcccaaatggcatat
agaaaatcaattaccttggttagagactatacgggcactttaccaattacaaaaatcttt
gaaagcttaccacagtcttcaattgcagaagataatacgaataatattttgcttttaact
cctttgttaaaccctatatatcctagaagtcatggtgagaatggtgagccacaattgtat
acgggggaagaagtatttcaaaaattcggtgattttctatctagtcattccaaaaattta
aagtctaaaaatccttatagcgtgctacacacaacatatacagcgaatggtcttactgca
ttgcatgaatccttgattgaaaattcaaaagctgttattgtgttaacatcagaagcgtct
cgaaatatgtatcaaattgggattgttaaatatatttctatattatgtggtgcgaatcct
tcgtctttcaacaataccgcctcgtctcattctcagttggcaaaaccattgataattgtt
gctactctgtcaccgtatgacttcttttataacaaaagtatcggaagtgcatatttatgt
tgttatgattatacaaataatgttttgaaagaattggctggtgtattaatgggtgatatc
caagcagaaggctgtattcctggagaaaagaaatttgttggaaaactgagaaaaagaaag
tcaattgattcacaaaatactggagaaaagcataaccaactaaaagaacgaagaagttct
caacctaagcgtagatggttagtggatgaatttgatttgaaacgtgactgggctggtttg
attaatatatggaagagtaatactgattcaagttcaaacgttgacgaccttactgtcaat
gtatcaaataatcaatctggagaaataacgtaccaagatgaatccttttacaaaaaaatg
tatcagttgctatctactaccgctaatactcagaaacattttgtaattagaaattcatcc
ttaaatattctatacggttttgttttaacatgggttgatgatagccaaggagttcctttg
gatggcgatctaactaagctggataatattcaaaaaaagactggctcaatcatgtattta
ttggtggataaatcaaaacgattacagagtatcggaaagaatttgcatgctagagcgata
agatatttaacgaaagaacaaaaatgcaccagcctcacattaggttgctcgtttccgtta
ttagtcttgccaaaaaattctaatttattaacaaataataaggtagtctcatttatgaat
aacgttgggtgggacgtgtctaacgattattctaagaaacatattatggtgttgtacgat
ttgaacaattggctggttcccaagaaaatttttagagagttgacaatagtgggtgtaaga
tttgatgtttgtactgatccacaaaaattgatgaatttaatacatagcagtatcctgcaa
catgataaactggtgaaaaattctataaggctgggaacacgcatgagggaagacaaagat
aacacgaaggaagtatatatagaggcaattaaatatttgactaacagcccgtcatatgga
gtgaaaataattattgctttagagccaaccaaccaaaatattattggaagtataatattg
tttaccaataagtcacaaatgtctaaattttatccgttcttagaagaatgcttgaaagat
tcgaagacactagaaaacctgaacctgcaagatccattaattggaggtataatggctcca
gttatagatccgtcttactcgaatttgacagaaattattaattttgggcttatatgtagt
gcaataacgttcgcaaaaactggatttaatgataatgatcaaaatcaaatgaataaatgt
gttatgatgggtataaacgatgataatttgggaaatatcagtgggatcaaagaaataggc
tttgaggagtggaaatatttctatgatttttacgacgctaaaaatgatgttgaaaaatca
ttcctaggagaataa

DBGET integrated database retrieval system