KEGG   Debaryomyces hansenii: DEHA2E18656gHelp
Entry
DEHA2E18656g      CDS       T01026                                 

Definition
DEHA2E18656p
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
dha  Debaryomyces hansenii
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:dha00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    DEHA2E18656g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
E:1539540..1545314
Genome map
AA seq 1924 aa AA seqDB search
MYNIMTGSNTDLNWSTDIFVDCYNSIKYQDQLNLNLLSNLRNDLFHILNIPSKSDISRNK
LIDESNPVKFSNGDEFRLNKEFIESSIYLSTELNIDEVLTAELLYNSTKLSYEKGTTFID
SGRLAYFTRLQLILNILGYLISSKNLHLVVNENYDEFFNNLLLSFQKVYEILEKVNDLID
KQKVTDDINNLSFINTINYIKSQLFNSHEVLGQIYFSLVDTYFERFGSLKYYEKIVDHIS
KTIHDNDILIVHYLPGLLRFITNLSEMPDVEVFQFHKQIVTRLSSEYDKVVSDEFVDLSK
SNLKGFEMVLNFMMLTCFIPWCKQSESRTNSIDFKDDILRYIEMCISCGVTEVLLCYAAD
TSNYKTTELLDWSNMYDFRSLLQTNFPRLSPAKFVYTNSDDLINLVNLRPQEFENINKLL
DVSNYKVSEDFNQNLLAPFFHIFFNNFISNAAIILTSLRDNEEDFLLSSINKKQLENDEK
ISKGDEGIDNDKDGDRHDTKKFSANKSNGNDQGIDLDEIATRSDLERFYLAFVYTYNNRQ
ELCSLFWSNEEITNDIIGFVTWGLSNNTSPLISATFCLLLGSLTSSGDDAAIKIWEILVN
NNGSATNASGTLKKDFSKISIDSIIDSLNYYIESLNENFEQDLNYQAKLQQKRQEFLFSS
SFNNTDITNESDNYPLNKVLIELSEDSVVFISGFMQLISSIVGNLSSTNERSKEIKNIAF
TRFSPIICSFLKFDNIITFTRSIQSSNNTFTVSNGSSNSKTTDSLNVLVNDDNRVILVNL
LLNLLTDFVKNEENLTIRYKVWNIIDRWISQSMNEGDSSKANNNKYSGNFINLSNSLNGI
SNNIQSQSRLKYPNKRTVTMRQGFQFCLTRLSLVGNFTKLVSHLLRPLETESQKAFTTYK
LLYPADLGAGYRYNNQIGIWPYVEYLLLEVFSKSDDLPNKNDQYNLQLSLGSLIERSLSE
IDWVFLNDVAPNIINNLKNLDNIVDSLSSSNPITYQLFIKLHHSLAVLNYLFDEKVYKSL
FNIISIGTESINENEGLSILVDKCLTILDKVLEVQDTFIHRLLPILKSEKIQSFSGSSSA
GFGTSMSLALSAPKSVYDNIYYPKSIGTNGISDFYEIFLFNLASIAHFALYVSSPQLSIA
NSAIKILHKISLSPFFIAKVEHNSADPLLNKNRLLTVFESIDESVKIQFSFIQQIERYIE
DYDDLQVKFSILQFLIDNLQQSIGEPGVSHFLLGYEIRGGNLFLNDSRSKNTLLKSLLKS
LSSSLDLISEIDYNNGNIHIIDAAPAELSSKILEIFVKLCHDPISSNITLNYLRNYNLES
NDLFAKLIDCQPKIDPNTIWSNAKFQGDLQDGKMNSFIQDSLAPRALLSFINHRNLILQY
LSLEFLNISQQRAIIKKDSYIDLLLNGNEFLNGSPKILNFLDVLNFKFFNFEIHKYELFN
GKYNLPLILEQMTKNKLSTHVLDTSVLENLYKVICKNANGQLQNKESKISFSQEVMDEGS
KITEFLTKYIISIELKNVQLSCLHSWTQLIQVLVSDGDMSLTRKSNLILEIFQIILPKIN
DYLGQDISFSEEFISLCVLLFDLYEQESSSATQENDKVSLYIDRLIPLFKTCINGIMSSN
STPDLRSDLYVLVNKFLQKSFKNSDLIKQIIMIIKSVDSKFIDIISNDSICAEGAPRITS
LLLLESLIHLTSSNKVNFILELMIKNNSLSLLVRSIKRTDEMLSHYSDSSSSKNGIDTLL
YELTAFKSTLYFLIRIAQTRLGSSQLIQNEIFSIIKQCKFLSIDPDLGLDLKINELSGNN
KSIYISLSLDTPISLIDVNKHHTSEKDNKISFFEFLVPIFQLISAVLLSMGPSYKPSIIQ
AKDLLHHFDRLVVGVMKRDVLIENTQIQSQKYQEDSISYVGLKDLVQLIVLLDSLVNYES
NDKN
NT seq 5775 nt NT seq  +upstreamnt  +downstreamnt
atgtataatataatgacaggatctaacactgatttaaattggtctactgatatatttgtt
gattgctacaattcaattaaatatcaagatcaacttaacctcaacttgttaagtaattta
aggaatgatttattccatatattaaatataccttcgaagagtgatatatccagaaacaaa
ttgattgatgaatccaatccagtaaaatttagtaatggcgatgagttcagattaaataaa
gaatttattgaatcatcgatttacttgtctacagaactaaatatcgatgaagtattaacg
gccgagctattatataactccactaaattaagttacgaaaaagggacaacattcattgat
agtgggaggttggcatatttcacgcgtttgcaattaatattgaacatcttgggctatttg
atctctagtaagaatttgcacttagttgtaaatgagaactatgatgagttctttaacaat
ctattattgagttttcaaaaggtatacgaaatcctagagaaagtaaatgacttaattgat
aaacagaaagtaactgatgatataaataacttatcatttattaacaccataaattacatt
aagtcccaattatttaatagtcatgaagttttaggacagatatattttagtttggtggat
acttattttgaacggttcggatcattaaagtattatgagaagattgtcgatcacattagc
aaaactatacatgataatgatatccttattgttcattatttgccaggtttattgaggttc
attactaacttgtctgagatgccagatgtggaagttttccagtttcataagcaaattgta
acaagattgagcagtgaatatgataaagtagtgtcagacgaatttgtagatttatcgaaa
tctaatttaaagggattcgaaatggttttgaatttcatgatgctaacttgtttcattcca
tggtgtaaacagtcggaatcacgcactaattcgattgattttaaggacgatattttaaga
tatattgaaatgtgtataagctgtggggttacagaagtattgttatgttacgcagctgat
acttccaattataaaacaacagaattattggattggagtaatatgtatgattttagatcg
ttactacaaacaaattttcctcgtctaagtcctgctaaattcgtctatactaattccgac
gatttaattaatttggtgaatttgaggccgcaggaatttgaaaatataaacaagttactc
gatgtttcaaattataaggtatcagaagattttaatcaaaatttgttggccccgtttttc
cacattttctttaataactttataagtaatgcggcaattatactaacgctgttaagagat
aatgaagaagattttctattatcatcaatcaataaaaagcaattagaaaatgatgaaaag
atttctaaaggtgatgaaggtattgataacgataaggatggtgataggcatgacactaaa
aaattttcggccaataagtcaaatggcaatgaccagggtattgatttagatgaaattgca
actcgatctgacttagaacgattctatttggcatttgtgtacacctataataatagacaa
gaattgtgctcattattttggtctaacgaggaaataactaatgatataatagggtttgtt
acatggggattgagcaacaatacttctccattaatttctgcgacattttgtttattattg
ggatcactcacatcaagtggcgatgatgcagctattaaaatatgggagattttagttaat
aacaacggttctgcaaccaatgctagcggtactttgaaaaaagatttttctaaaatatca
attgattccattattgactcgttaaattattatatcgaatccttgaatgaaaactttgaa
caggatttgaattatcaagctaaattacaacaaaaaaggcaagaattcttattttcttcg
tctttcaataatacagatatcactaatgaatcagacaattatccattaaataaggtgtta
attgaactatctgaggattcagttgtttttatttcgggttttatgcaattaatctcttcg
attgttggaaacttatcctcgacaaatgaaagatccaaggaaatcaagaatatagctttt
actcgattcagtcctataatctgttcatttttgaaattcgataatataatcacttttaca
agaagtattcagtcaagtaataatacgtttacagtgtctaatggttctagcaattctaaa
acaacagattctttaaacgttttagttaatgacgacaatagagtcattcttgttaactta
ttgctaaacttattgaccgattttgtcaagaatgaagaaaatttaacaataagatataaa
gtttggaatataattgaccgttggatatcgcaaagtatgaacgaaggcgattcatcaaag
gctaacaacaataaatatagtggtaattttattaacctatcgaattccctaaacggaatt
tcaaataatatacaatctcaatcgagattaaaatatccaaataaacgcactgttactatg
agacaggggtttcagttttgtttgactcgtctctctcttgttggaaatttcacgaaatta
gttagccatctattaaggccactcgaaacggaatctcaaaaggcattcacaacttataaa
ttactataccctgctgatttgggagccggatatcgttataacaatcaaatcggtatttgg
ccttatgttgaatatttattgcttgaggtcttttcaaagtcagatgatttgcctaataaa
aatgatcagtataacttgcaattatcattgggtagtttaattgaacgttcattaagcgaa
atagattgggttttcctaaatgatgttgctcctaatataattaacaacttgaaaaattta
gataacattgttgactccttgtcttcaagtaatccaattacctatcaactattcattaaa
ttacaccattctttagctgtattgaattatttatttgatgaaaaagtttacaagtcactt
ttcaatattataagtattggtactgaatctatcaatgagaacgaaggcttaagtatatta
gttgataaatgtttgacaattcttgataaggtattagaggtacaagatacattcatccat
agattattacctattttaaaaagtgaaaaaattcagtcatttagtggttccagttctgca
ggcttcggtacaagtatgagtttggcattatccgcgcctaaaagcgtttatgataatatc
tattatcctaagagtattggtactaatggaatatcagacttctacgaaatatttctattc
aatctagcaagtatagcccattttgcattatatgttagttcacctcagttgagcattgcg
aactcagctataaaaattttacataaaataagtttgtcgccattttttattgccaaagtt
gagcataattctgctgacccattgttgaataaaaatagattattaacagtcttcgagagt
atcgatgagtcggttaaaattcaattttcatttattcagcaaatagagagatatattgaa
gattacgatgatttacaagttaaatttagtatattgcaatttttgattgacaacctacag
caatctattggagaaccgggagtatcacacttcttgttaggttatgaaatacggggtggt
aacttgtttttgaatgattcaaggtcaaaaaatacattattaaaatcattacttaaatct
ttaagctcaagcttggatttaatttctgaaattgattataataatgggaacattcatatt
atcgatgcggctcctgctgaattatcatcgaagatcctagaaattttcgttaagctatgc
catgatccaatttcttccaatatcacattgaattatttgcggaattacaacttagaatca
aatgatttgtttgctaaattgatcgattgccaacctaaaatagatccaaatactatatgg
tctaatgctaagtttcaaggagatttacaagatggtaaaatgaatagttttattcaagat
tcattggctcctagggcattgctttccttcattaaccataggaatttaattttacagtat
ttatcattagaatttcttaatatctctcaacagagagcaattattaaaaaggattcttat
atcgacttattgctaaatggtaatgagttcttaaacgggtctccaaaaattttgaacttt
ctcgatgttttgaatttcaaattttttaattttgagatccataaatatgagcttttcaat
gggaaatacaatttaccattgatattagagcaaatgaccaagaataagttactgacccac
gtattagatacatcagttcttgaaaatctctataaggttatttgtaaaaatgcaaatggc
caattacaaaacaaagaatcaaaaatttcgttctcgcaagaagttatggatgaaggttcc
aaaattaccgaattcttgacgaaatatataatctccattgaactaaagaatgttcaatta
tcgtgtttgcattcatggacgcaattgatccaagtcttagttagtgatggagatatgtca
ttaactaggaaatcaaacctaatattggaaatttttcagattatattgccaaagatcaac
gattatttgggccaagacatttccttttctgaggagtttatttcattatgtgtcttatta
tttgatttatacgaacaagaaagttcatcggcaacacaagaaaatgataaagtatcttta
tatatcgataggttgataccattatttaaaacgtgtatcaatggaataatgagctcaaat
tcgacgcctgatttgaggtctgatttatatgttttagtgaacaagttcttgcaaaaatca
tttaaaaatagtgatttaataaaacaaataataatgattatcaagctggttgattcgaaa
tttattgatattattagtaatgattcgatttgtgctgaaggcgctccgagaatcacttca
ttattattattggaatcattgatacacctaacatcaagcaataaggttaattttatatta
gaattgatgatcaagaacaattcgttatccttacttgttaggtcaataaagagaactgat
gagatgctttctcattattctgattctagttcgctgaaaaatggaattgatacattgttg
tatgaattgactgcgtttaaatctacattgtatttcttaataagaatagcacaaactagg
cttggatcgtcacagctcattcaaaacgaaatcttttccattatcaaacaatgtaagttt
ttgtcaattgatcctgatttgggcttagatttgaagatcaatgaattgagtggtaataat
aaatctatttacattagtttatcgctcgatactccaatttcattgatagacgtaaacaaa
catcatacgtctgaaaaggacaacaaaatttcgttttttgaattcctagttccaatcttt
caattaatctctgctgtcttattatcaatgggaccatcatataaacctagcataatacaa
gcaaaggacttattgcatcatttcgatagattggttgttggtgtgatgaaaagagatgta
ctaattgaaaatacacagatacagtcccaaaaatatcaagaggattcaatttcatacgtg
ggcttaaaggatttggttcaattgattgtattattggattctttagtgaactatgaatca
aacgataaaaactag

  All links  
No link information was found.   
DBGET integrated database retrieval system