KEGG   Debaryomyces hansenii: DEHA2E19228gHelp
Entry
DEHA2E19228g      CDS       T01026                                 

Definition
DEHA2E19228p
Orthology
K18477  
protein arginine N-methyltransferase 2 [EC:2.1.1.-]
Organism
dha  Debaryomyces hansenii
Brite
Enzymes [BR:dha01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     DEHA2E19228g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
E:complement(1600831..1602135)
Genome map
AA seq 434 aa AA seqDB search
MSDLHELCGFQTRPIGPKYIEDLKFYLKNGIPATYTIEEAYNYTNNIEEEPTTTTTPLHI
ICSHIPNDASNDEIDIINQMVEILLEYGAGWCLTDINDDTPGCILIRRKLNNTPIYNQVV
AAGVRAELLLRKVSEYDMEIIEDTDDLNHEQFEGIQGEETTEEERKEEEPSNTSDIIDEQ
KVEQPKEDLKEDPSSNQETYLKTKLEYKDGALVTKDRKDGVMMSWETDLMRMGCDSLFKG
ASIDGEIDDEVNILNIGFGMGIIDTMINNKNPTKQYICEAHPDVLAKLRLDGWYEKQNVV
ILEGRWQEQLNKLLSEGNVFFNGIYYDTYSEHYEDMLELFDIVVGILKPHGVFSFFNGLG
ADRQVVYEVYKQLVEMDLANYGLICKFEQIEVPESTLQLEVQNSTDNKSVWDDIKRAYWT
CPTYYHPEARFMDV
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgtcggatttacatgagttatgtggttttcaaacgagacctattggacccaagtacatt
gaagatttaaagttttacttgaaaaatggtattcctgcaacctacacgatagaagaagca
tacaattatacaaacaacatagaagaggagccaactaccactactaccccattacatatt
atatgttctcatatacccaatgatgcttctaatgatgaaatagacattattaatcaaatg
gttgaaatcttgctcgaatatggtgccgggtggtgccttaccgatatcaatgatgacaca
ccaggttgtatattgatcagaagaaagttaaataacactccaatttacaaccaagtagtt
gctgctggtgttagagcagaattattattgagaaaagttagtgaatacgacatggaaatc
atcgaggacactgatgacttaaaccatgaacaatttgaaggcatacagggcgaagaaacc
acagaggaagagcgtaaagaagaggaaccttccaacacttcagatattattgatgaacag
aaagtcgaacaacctaaagaagatctcaaggaggatccttccagtaaccaagaaacttac
ttgaaaacaaaattggaatataaggatggtgccttagtaactaaggacagaaaagatggg
gtcatgatgtcctgggaaacagatttaatgagaatgggttgtgattctctttttaagggg
gcaagcattgatggcgagatagatgatgaagttaatattttgaatattggatttggtatg
ggaattatagatactatgattaataacaagaacccaactaagcaatacatatgtgaagca
catccagatgtcttggctaagttgcgtctcgatggttggtatgaaaaacaaaatgtggtt
atattagaaggaagatggcaagaacagttaaacaagcttttatccgagggcaatgtcttc
ttcaacggtatttattacgacacgtattctgaacattatgaagatatgttagaattattt
gatatagttgttggtatattaaagccccatggtgtattctctttcttcaatgggttggga
gcggacagacaagtggtttatgaagtatacaagcaattggtagaaatggacctagccaat
tacggtttgatttgtaaattcgagcaaattgaagttcctgaatcaaccttacagttagaa
gttcaaaattctacagacaacaaatcagtttgggatgacattaaaagagcttactggact
tgcccaacttactaccatcctgaagctagatttatggacgtttag

DBGET integrated database retrieval system