KEGG   Debaryomyces hansenii: DEHA2E19954gHelp
Entry
DEHA2E19954g      CDS       T01026                                 

Definition
DEHA2E19954p
Orthology
K04709  
Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
dha  Debaryomyces hansenii
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Ceramide biosynthesis
Brite
KEGG Orthology (KO) [BR:dha00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    DEHA2E19954g
Enzymes [BR:dha01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.24  sphingosine N-acyltransferase
     DEHA2E19954g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
E:complement(1656664..1657923)
Genome map
AA seq 419 aa AA seqDB search
MPSPEQKNLSPLRPSTSSGAQPGLRRRGSSVGNIDVGDTSPSFATSYTSKSQRKKSDARI
VELSKESDSDVAIVKKIGVAYREITYRHTWINPLLVLLAALGAFLVSGPDTIIHQVLEAM
MIPAYKIEGSDQYGKGMNDFYFVGFYAIFFTFLREFLMCCVLRPTATWLNITKEAKAKRF
MEQTYAMFYYGFSGPFGLWIMSTLPLWFFETLPFYESYPHKTHDFYFKVYYLGQAAFWVQ
QSVVLILQLEKPRKDFKELVLHHIITIALIWCSYRFHFTWMGLAVYITMDVSDFFLATSK
TLNYLNSPLTGPFFVLFVGIWIYLRHYLNLRILWSVLTEFRNVGEWELNWDTQQYKCWIS
QPIVFFLIGALQIVNAYWLFLIFRILWRYVAGGGTKDERSDDEDEEETESGEDETKKTE
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgccgtcgccagaacagaagaacttgtcaccactaagaccaagtacgtctctgggtgcc
caaccaggtctccgtcgtcgtggatcatcagttggtaatattgatgttggtgacacctca
ccatcatttgctacactgtacacgtctaagtcgcaaagaaagaagtcggatgccagaatt
gttgaattgtcgaaggagtcagactcggatgtggcaatagtgaagaagataggagttgca
tatcgagaaatcacgtacagacatacctggattaatccattgctcgtgttattggcagca
ttgggagcatttttggtttctggaccagataccattatccatcaggttttagaagctatg
atgatcccagcgtataagattgaaggttccgaccaatatggtaaaggtatgaacgatttc
tattttgttggattttatgcgatttttttcacattcttaagagagtttttgatgtgctgc
gtgttaaggcccaccgctacttggttgaatatcaccaaggaggccaaagctaaacgtttt
atggaacaaacctacgcgatgttctactatggattttctggtccatttgggttatggatt
atgtctaccttaccattatggttttttgaaacattaccattttacgaaagctacccccac
aagacccatgatttttacttcaaggtgtactatttgggtcaagcagcattttgggtccaa
caatctgttgttttgattttgcaattagagaaacctcgtaaggatttcaaagagcttgta
ttgcaccacattattaccattgcattgatctggtgttcgtaccgtttccactttacctgg
atgggcttagcagtttatatcactatggatgtttctgacttcttcttggctacttcgaaa
actttgaactacttgaactctcctttaacaggcccattcttcgttttgtttgttggaatt
tggatctatttgagacactacctcaatttacgtatcttatggtctgtattaactgaattt
agaaacgtcggagaatgggaacttaactgggacactcagcaatataaatgttggatttcc
caacctattgtgttcttcttaattggtgcgttgcagattgttaatgcctactggttattt
ttgattttccgtatcttgtggagatacgttgctggtggtggtactaaggatgaaagaagt
gatgacgaagatgaggaagaaaccgagtctggtgaagacgaaaccaagaaaaccgaataa

DBGET integrated database retrieval system