KEGG   Debaryomyces hansenii: DEHA2E20086gHelp
Entry
DEHA2E20086g      CDS       T01026                                 

Definition
DEHA2E20086p
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
dha  Debaryomyces hansenii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
E:complement(1668707..1669831)
Genome map
AA seq 374 aa AA seqDB search
MSQLKPRRIIFNISQNFQVIQVVGEGAYGVVCLAIHKPTGIKVAIKKLEPFEKPLFCLRA
LREIKLLTYFKKHENIISIFDVQKPLNFENFNEIYLIQEYMPSDLHKTIATQNLTDDHIQ
YFIYQILRGLKLIHSANVIHRDLKPSNILVNENCDLKICDFGLARLDILKEGYDKRLAIN
SGISMLTEYVATRWYRAPEIMLTSSQYSTAIDMWSVGCILAELFTCTPLFPGNDYRHQLI
LIFQLLGTPTDADLTCIKSQRAKNYIKTLPYCSPLSLDQVFNRHPNRAKRFGGQPINPLG
LDLLKKLLVFDPKERLTVEEALEHPYVSTYHDPEDEPTIMPIPHEDFEFDKSKDKLSILE
LKRQLYNDIIKCNR
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgctgcagttaaagcctaggaggattatttttaatatttcccagaatttccaagttatt
caagttgttggcgagggtgcttacggtgtcgtctgtttggctatacacaagccaactggg
ataaaggtagcaataaagaaacttgaaccctttgaaaagccacttttttgtcttcgagct
ttaagagagatcaagcttttgacatattttaaaaagcatgaaaatatcatttcaatcttt
gatgttcaaaaaccacttaattttgaaaacttcaatgaaatttacttaattcaagaatat
atgccaagtgatttacataaaactatagctacccaaaatcttacggatgatcatattcaa
tattttatataccaaatattgagggggttaaaattaattcatagtgctaatgtgattcat
cgagatttaaaaccttcgaatatacttgtgaatgagaattgtgacttgaaaatttgtgat
tttggtttagcaaggctagatatactaaaagagggatacgataagagattagcaatcaat
tcaggaatatcaatgttaacagaatatgttgcaacaaggtggtatagggcgccagaaatt
atgttaacctcttcacaatattcgacagccatagatatgtggtcagtaggttgcatattg
gcagagctttttacatgtactccattgtttcctggaaatgattatagacatcaattgata
ctaatattccaattacttggtacaccaactgatgccgatttgacttgcattaaatcgcaa
agagctaaaaattacattaaaacgctaccttattgtagtccgttaagcttggatcaggta
tttaatagacatccaaatcgtgcgaaaagattcggaggtcaacctataaacccattagga
cttgacttgctaaagaagttattagtgtttgatcccaaagagagattgaccgtggaagag
gcactagagcacccttatgtttctacatatcatgaccccgaagacgaaccaacaattatg
cccataccacatgaggattttgaatttgataagagcaaggataaattgagcatccttgaa
ctcaaacgccaattatacaatgatataattaaatgcaaccggtga

DBGET integrated database retrieval system