KEGG   Debaryomyces hansenii: DEHA2E21274gHelp
Entry
DEHA2E21274g      CDS       T01026                                 

Definition
DEHA2E21274p
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
dha  Debaryomyces hansenii
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dha00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    DEHA2E21274g
Enzymes [BR:dha01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     DEHA2E21274g
Transfer RNA biogenesis [BR:dha03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    DEHA2E21274g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
E:1755290..1756390
Genome map
AA seq 366 aa AA seqDB search
MSTVPSNHPYYKELEIASIAVMRTSILTKELSDSIATTQKSGTHTKDDKSPVTIGDYASQ
AIINHAIKLNFPEDEIVGEEDAEVLRKDNAEGKDLSAKVLEIISDVQSQTSQYNDRLGKL
ENEAEIYDSIDLGNSQGGSKGRFWALDPIDGTKGFLRGDQFAVCLALIEDGKVVLGVIGC
PNLPATVISNEEMSGTKGGLFSAVRGVGSFYSNLFDKQDFTPLAEQEKIKMTQHTSPESL
KVVEGVEKGHSSHSTQSQIKDKLGFNNETVSKQTINLDSQVKYCVLAKGQADVYLRLPIS
DTYREKIWDHAAGNILVYESGGLVGDIHGNELNFGNGRHLNSQGVVAGNKSVFKKVIEAV
GDVLQA
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgtctacagtaccttcaaaccatccatattataaggaattggaaattgcatctatagca
gttatgagaacctcgatcttgacaaaggaattgagtgactcaattgctactacgcaaaag
tctgggacacatacgaaagatgataagtcccctgtcactatcggagactatgcatctcaa
gctattatcaaccatgcgattaaactcaactttccagaagacgaaattgtaggtgaagaa
gatgcggaagtattaagaaaggataatgctgaagggaaggacttaagtgctaaagtatta
gaaattatttcggatgtgcaatcccaaaccagccaatacaatgatagattaggaaaactc
gaaaatgaggctgaaatatatgatagtattgatttgggtaattcccaaggtggctccaag
ggacgtttctgggcgttagatccaattgatggtaccaaagggtttttaagaggtgaccaa
tttgcggtttgtttagcgttgatagaggacggaaaagtcgtgttaggagttattggatgt
ccaaatttaccagctacggttatttctaatgaggaaatgagtggcacaaaaggaggctta
ttctctgctgttagaggtgtaggttctttctactcaaatttatttgataaacaagatttc
acgccgttagccgagcaagaaaagatcaaaatgactcaacatacttcaccagaatcatta
aaggttgttgaaggtgtagaaaagggccattcttctcactcaactcaatcccaaataaag
gataagttaggtttcaacaatgaaacggtttcaaagcaaactattaatttagattcgcaa
gttaagtactgtgtattggcaaaaggacaagctgacgtatatttgcgcttgcctatcagt
gacacatatcgtgaaaagatttgggaccatgctgctggtaatatcttagtttacgaaagt
ggcggacttgtaggagatattcatggtaacgaattgaacttcggaaatggaagacacttg
aattctcaaggggtagttgcaggtaataaatcagtttttaagaaagtgattgaagctgtt
ggtgatgttttacaagcatga

DBGET integrated database retrieval system