KEGG   Debaryomyces hansenii: DEHA2E23628gHelp
Entry
DEHA2E23628g      CDS       T01026                                 

Definition
(RefSeq) DEHA2E23628p
  KO
K09580  protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
dha  Debaryomyces hansenii
Pathway
dha04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:dha00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    DEHA2E23628g
Enzymes [BR:dha01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     DEHA2E23628g
Chaperones and folding catalysts [BR:dha03110]
 Protein folding catalysts
  Protein disulfide isomerase
   DEHA2E23628g
Membrane trafficking [BR:dha04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    DEHA2E23628g
Exosome [BR:dha04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   DEHA2E23628g
  Exosomal proteins of colorectal cancer cells
   DEHA2E23628g
  Exosomal proteins of bladder cancer cells
   DEHA2E23628g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 Thioredoxin_2 Thioredoxin_7 OST3_OST6
Motif
Other DBs
NCBI-GeneID: 2902574
NCBI-ProteinID: XP_460327
UniProt: Q6BN93
Position
E:1927969..1929603
Genome map
AA seq 544 aa AA seqDB search
MKFWKFSTQALASLLTAVSVVNASGPTDGEAAADPNSAVVQLTTSEFKSFMDANPLVLTE
FFAPWCGYCKVLGPEFAQAADSLNESHPNIKLAQVDCTVEEELCMEHGIRGYPSLKIMRG
SEAAPEDYDGPREAAGIADYMIKQSLPAVSSPVETEELTSLIDAQEKPYIIQVLPEGYNG
DKDKANSDETFAEVANENRKDLTFISVENKDLVDSLKSKLPKASLNKVKSPKYLLVRPDS
PEDITEFSATLDKESLTSFIKTEIVPYFGDINRDTFLMYMTSPLPLGYYFYNNEEERKVV
EETFKKLGKEYRGKINFVGLDANVFGRHAEALNMNPEVVPLFAIQNLQENKKYGISQEEN
PKGPSTKTIEKFVKDFIKGKVDPIVKSEPLPTKEEIANQSVVKLVSHNHDDILKDTSKDI
LVKYYAPWCGHCKKLAPTWEELAGIFGSNKPDSKVVIADLDHTANDVNTPVEIAGYPTLV
FYPANGKIDSKTGLREAVVYDKPRELDSLIEYIKEQGGHKIDGNQLRESKEAIVEEDEVN
HDEL
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgaagttctggaaattttctactcaagctttagcttcgttattgaccgctgtatcagtt
gtcaatgctagcggaccaacagacggcgaagccgctgcggacccaaactcagcggttgtt
caattaactacttcagaattcaaatctttcatggatgctaatcctttggttttaactgag
ttctttgcaccatggtgtggatactgtaaggttttgggaccagaatttgcccaggctgct
gattcattgaacgaatcacacccaaatatcaaattggcacaagttgattgtaccgttgaa
gaagaattatgtatggaacacggtattagaggatacccatcattgaaaattatgagaggg
tcagaagctgctccagaagactatgatggtccaagagaagctgcgggtattgctgattac
atgatcaagcaatcattaccagctgtttcgtctccagtcgagactgaagaattgacctct
ttgatcgatgctcaagaaaagccttacattattcaagttttaccggagggttacaacggc
gataaggataaagctaattctgacgaaacttttgctgaagttgccaacgaaaacagaaag
gacttgactttcatttctgttgaaaataaagacttggttgattctttgaagtccaagctt
cctaaggctagtttgaacaaggttaagtctccaaagtacttgcttgtgcgtcctgattct
cctgaagacatcactgaattctctgctactttagataaggaaagcttaacgtctttcatc
aagaccgaaatcgttccatacttcggtgatatcaatagagatacctttttgatgtacatg
acttcgcctttgccacttggttactatttctacaataatgaagaagaacgtaaagtggtt
gaagaaactttcaagaagttaggaaaggaatacagaggtaaaatcaactttgttggtttg
gatgctaatgtatttggacgtcatgccgaagcattaaatatgaacccagaagttgttcct
ctttttgcaattcaaaaccttcaagaaaacaagaagtacggtatcagccaagaagaaaac
cctaagggtccttctactaagactattgaaaagtttgttaaggacttcatcaagggtaaa
gtagacccaatcgtcaagtctgaaccattgccaaccaaagaagaaattgccaaccaatcg
gttgttaagttagtctctcacaaccacgatgatattcttaaggatacttcgaaggatatt
ttagttaaatattacgccccatggtgtggacattgtaagaaattggcaccaacatgggaa
gaattggccggtatttttggttcgaataagcctgattctaaggttgttatcgctgacctt
gatcacaccgctaacgatgttaataccccggttgaaatcgctggttacccaactttggtg
ttctatcctgctaatggtaagattgacagcaaaactggtctcagggaagctgttgtatac
gacaaaccaagagaattagattctttgattgaatatattaaggaacaaggtggtcataaa
attgatggcaaccaattaagagaatctaaagaggccatcgttgaggaagatgaagttaat
catgacgaattatga

DBGET integrated database retrieval system