KEGG   Debaryomyces hansenii: DEHA2E23628gHelp
Entry
DEHA2E23628g      CDS       T01026                                 

Definition
DEHA2E23628p
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
dha  Debaryomyces hansenii
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:dha00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    DEHA2E23628g
Enzymes [BR:dha01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     DEHA2E23628g
Exosome [BR:dha04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   DEHA2E23628g
  Exosomal proteins of colorectal cancer cells
   DEHA2E23628g
  Exosomal proteins of bladder cancer cells
   DEHA2E23628g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
E:1927969..1929603
Genome map
AA seq 544 aa AA seqDB search
MKFWKFSTQALASLLTAVSVVNASGPTDGEAAADPNSAVVQLTTSEFKSFMDANPLVLTE
FFAPWCGYCKVLGPEFAQAADSLNESHPNIKLAQVDCTVEEELCMEHGIRGYPSLKIMRG
SEAAPEDYDGPREAAGIADYMIKQSLPAVSSPVETEELTSLIDAQEKPYIIQVLPEGYNG
DKDKANSDETFAEVANENRKDLTFISVENKDLVDSLKSKLPKASLNKVKSPKYLLVRPDS
PEDITEFSATLDKESLTSFIKTEIVPYFGDINRDTFLMYMTSPLPLGYYFYNNEEERKVV
EETFKKLGKEYRGKINFVGLDANVFGRHAEALNMNPEVVPLFAIQNLQENKKYGISQEEN
PKGPSTKTIEKFVKDFIKGKVDPIVKSEPLPTKEEIANQSVVKLVSHNHDDILKDTSKDI
LVKYYAPWCGHCKKLAPTWEELAGIFGSNKPDSKVVIADLDHTANDVNTPVEIAGYPTLV
FYPANGKIDSKTGLREAVVYDKPRELDSLIEYIKEQGGHKIDGNQLRESKEAIVEEDEVN
HDEL
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgaagttctggaaattttctactcaagctttagcttcgttattgaccgctgtatcagtt
gtcaatgctagcggaccaacagacggcgaagccgctgcggacccaaactcagcggttgtt
caattaactacttcagaattcaaatctttcatggatgctaatcctttggttttaactgag
ttctttgcaccatggtgtggatactgtaaggttttgggaccagaatttgcccaggctgct
gattcattgaacgaatcacacccaaatatcaaattggcacaagttgattgtaccgttgaa
gaagaattatgtatggaacacggtattagaggatacccatcattgaaaattatgagaggg
tcagaagctgctccagaagactatgatggtccaagagaagctgcgggtattgctgattac
atgatcaagcaatcattaccagctgtttcgtctccagtcgagactgaagaattgacctct
ttgatcgatgctcaagaaaagccttacattattcaagttttaccggagggttacaacggc
gataaggataaagctaattctgacgaaacttttgctgaagttgccaacgaaaacagaaag
gacttgactttcatttctgttgaaaataaagacttggttgattctttgaagtccaagctt
cctaaggctagtttgaacaaggttaagtctccaaagtacttgcttgtgcgtcctgattct
cctgaagacatcactgaattctctgctactttagataaggaaagcttaacgtctttcatc
aagaccgaaatcgttccatacttcggtgatatcaatagagatacctttttgatgtacatg
acttcgcctttgccacttggttactatttctacaataatgaagaagaacgtaaagtggtt
gaagaaactttcaagaagttaggaaaggaatacagaggtaaaatcaactttgttggtttg
gatgctaatgtatttggacgtcatgccgaagcattaaatatgaacccagaagttgttcct
ctttttgcaattcaaaaccttcaagaaaacaagaagtacggtatcagccaagaagaaaac
cctaagggtccttctactaagactattgaaaagtttgttaaggacttcatcaagggtaaa
gtagacccaatcgtcaagtctgaaccattgccaaccaaagaagaaattgccaaccaatcg
gttgttaagttagtctctcacaaccacgatgatattcttaaggatacttcgaaggatatt
ttagttaaatattacgccccatggtgtggacattgtaagaaattggcaccaacatgggaa
gaattggccggtatttttggttcgaataagcctgattctaaggttgttatcgctgacctt
gatcacaccgctaacgatgttaataccccggttgaaatcgctggttacccaactttggtg
ttctatcctgctaatggtaagattgacagcaaaactggtctcagggaagctgttgtatac
gacaaaccaagagaattagattctttgattgaatatattaaggaacaaggtggtcataaa
attgatggcaaccaattaagagaatctaaagaggccatcgttgaggaagatgaagttaat
catgacgaattatga

DBGET integrated database retrieval system