KEGG   Debaryomyces hansenii: DEHA2F03872gHelp
Entry
DEHA2F03872g      CDS       T01026                                 

Definition
DEHA2F03872p
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
dha  Debaryomyces hansenii
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:dha00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    DEHA2F03872g
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    DEHA2F03872g
Enzymes [BR:dha01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     DEHA2F03872g
Lipid biosynthesis proteins [BR:dha01004]
 Desaturase
  First
   DEHA2F03872g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:348314..349768
Genome map
AA seq 484 aa AA seqDB search
MSDKVEVADVTSLNALAAGTNKKNPRVVAAGLGGRLMGTKSLVDVTADEITKDSESSLAE
KDRKDKEKWTKMTHISDQPWTWSNWSEHINWLNLILVVLVPTVGFVCALRHPPQLKTAVM
GVILYILSGLSITAGYHRLYSHKAYDAAVPVKIFFALFGAGAVEGSIKWWGHSHRVHHRY
TDTARDPYDARQGLWYSHMGWLLIKANPKNRARADISDLTGDWVVNFQHRHYLVIMIFMA
LVLPTLIAGLGWGDYWGGFVYGGIIRSFFIQQATFAINSLAHWIGSQPFDDRRTPRDNVI
TALVTFGEGYHNFHHEFPSDYRNALIWYQYDPTKITIWVLSKLGLAWGLKTFSQNAIEQG
LIQQQQKKLDRMKSKLEWGTMLNELPLMDKEEFTARAKKDGLILISGIVHDVKQFIKQHP
GGQALIRVSLGKDATKAFNGMVYAHSNAAHNMLANMRIAILKDHAVNGNTFDLQQEFLDK
EKVN
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgtcagataaagttgaagtagcggacgttacgtcgcttaatgctttagcagcaggtact
aataagaaaaacccaagagttgtcgcagctggtttgggtggacgtttgatgggtaccaag
tcattggtggatgtcaccgcagacgaaatcaccaaggactctgaactgtcgttggcagaa
aaggatagaaaagacaaggaaaagtggaccaaaatgacccatatttcggaccagccatgg
acttggtcaaattggtcggaacacattaactggttgaatttgattttggtagttcttgtt
cctaccgttgggtttgtgtgtgcattgagacacccaccacaacttaagacggcagtaatg
ggagtgatactttacattttgtcgggtttgtcgatcacggctggataccatagattgtac
tctcacaaggcgtacgacgcagcagtaccagtcaagattttctttgctctttttggtgca
ggtgcggttgaaggttccattaaatggtggggccactcgcacagagtgcaccacagatac
accgataccgctagagatccatatgatgccagacaagggttatggtactcgcacatggga
tggttgttgattaaggccaaccctaagaacagagccagagcggatatttctgacttgacc
ggtgactgggtggttaacttccaacaccgtcattatctcgtaataatgattttcatggcc
cttgtgcttccaactttgattgctggattaggatggggtgattattggggtggattcgtc
tacggaggaatcatcagatctttcttcattcaacaagccacatttgctatcaattcgtta
gcacactggattggaagtcaaccattcgacgatagaagaacccctagagataatgttatc
actgcattggtcacctttggtgaaggttaccacaacttccaccacgaattcccatcggat
taccgtaatgctttaatatggtaccaatatgatccaactaagatcaccatttgggtgtta
tccaagttgggattagcatggggtttaaagacattttctcaaaatgccattgaacaaggt
ttgatccaacagcaacaaaagaagttggacagaatgaagtccaagttggaatggggtacc
atgcttaatgaattgcctcttatggataaggaagagtttactgcaagagctaagaaggat
ggcttgattcttatttctggtattgttcacgacgttaagcaattcatcaagcaacatcct
ggtggtcaagcattgattagagtctcattgggtaaggatgccactaaggctttcaacggt
atggtctacgcccattctaatgctgcccacaatatgttggcgaacatgagaatcgccatt
cttaaggaccacgccgttaacggtaataccttcgacctccaacaagaattccttgataaa
gaaaaggttaactga

DBGET integrated database retrieval system