KEGG   Debaryomyces hansenii: DEHA2F03872gHelp
Entry
DEHA2F03872g      CDS       T01026                                 

Definition
DEHA2F03872p
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
dha  Debaryomyces hansenii
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:dha01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:dha01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:348314..349768
Genome map
AA seq 484 aa AA seqDB search
MSDKVEVADVTSLNALAAGTNKKNPRVVAAGLGGRLMGTKSLVDVTADEITKDSESSLAE
KDRKDKEKWTKMTHISDQPWTWSNWSEHINWLNLILVVLVPTVGFVCALRHPPQLKTAVM
GVILYILSGLSITAGYHRLYSHKAYDAAVPVKIFFALFGAGAVEGSIKWWGHSHRVHHRY
TDTARDPYDARQGLWYSHMGWLLIKANPKNRARADISDLTGDWVVNFQHRHYLVIMIFMA
LVLPTLIAGLGWGDYWGGFVYGGIIRSFFIQQATFAINSLAHWIGSQPFDDRRTPRDNVI
TALVTFGEGYHNFHHEFPSDYRNALIWYQYDPTKITIWVLSKLGLAWGLKTFSQNAIEQG
LIQQQQKKLDRMKSKLEWGTMLNELPLMDKEEFTARAKKDGLILISGIVHDVKQFIKQHP
GGQALIRVSLGKDATKAFNGMVYAHSNAAHNMLANMRIAILKDHAVNGNTFDLQQEFLDK
EKVN
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgtcagataaagttgaagtagcggacgttacgtcgcttaatgctttagcagcaggtact
aataagaaaaacccaagagttgtcgcagctggtttgggtggacgtttgatgggtaccaag
tcattggtggatgtcaccgcagacgaaatcaccaaggactctgaactgtcgttggcagaa
aaggatagaaaagacaaggaaaagtggaccaaaatgacccatatttcggaccagccatgg
acttggtcaaattggtcggaacacattaactggttgaatttgattttggtagttcttgtt
cctaccgttgggtttgtgtgtgcattgagacacccaccacaacttaagacggcagtaatg
ggagtgatactttacattttgtcgggtttgtcgatcacggctggataccatagattgtac
tctcacaaggcgtacgacgcagcagtaccagtcaagattttctttgctctttttggtgca
ggtgcggttgaaggttccattaaatggtggggccactcgcacagagtgcaccacagatac
accgataccgctagagatccatatgatgccagacaagggttatggtactcgcacatggga
tggttgttgattaaggccaaccctaagaacagagccagagcggatatttctgacttgacc
ggtgactgggtggttaacttccaacaccgtcattatctcgtaataatgattttcatggcc
cttgtgcttccaactttgattgctggattaggatggggtgattattggggtggattcgtc
tacggaggaatcatcagatctttcttcattcaacaagccacatttgctatcaattcgtta
gcacactggattggaagtcaaccattcgacgatagaagaacccctagagataatgttatc
actgcattggtcacctttggtgaaggttaccacaacttccaccacgaattcccatcggat
taccgtaatgctttaatatggtaccaatatgatccaactaagatcaccatttgggtgtta
tccaagttgggattagcatggggtttaaagacattttctcaaaatgccattgaacaaggt
ttgatccaacagcaacaaaagaagttggacagaatgaagtccaagttggaatggggtacc
atgcttaatgaattgcctcttatggataaggaagagtttactgcaagagctaagaaggat
ggcttgattcttatttctggtattgttcacgacgttaagcaattcatcaagcaacatcct
ggtggtcaagcattgattagagtctcattgggtaaggatgccactaaggctttcaacggt
atggtctacgcccattctaatgctgcccacaatatgttggcgaacatgagaatcgccatt
cttaaggaccacgccgttaacggtaataccttcgacctccaacaagaattccttgataaa
gaaaaggttaactga

DBGET integrated database retrieval system