KEGG   Debaryomyces hansenii: DEHA2F03938gHelp
Entry
DEHA2F03938g      CDS       T01026                                 

Definition
DEHA2F03938p
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
dha  Debaryomyces hansenii
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:dha00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    DEHA2F03938g
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DEHA2F03938g
  Lipid metabolism
   00071 Fatty acid degradation
    DEHA2F03938g
  Amino acid metabolism
   00350 Tyrosine metabolism
    DEHA2F03938g
Enzymes [BR:dha01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     DEHA2F03938g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:353823..354863
Genome map
AA seq 346 aa AA seqDB search
MSIPKTQKAIIFETSGGELKYADIAVPKPKPNEILINVKFSGVCHTDLHAWKGDWPLPTK
LPLVGGHEGAGEVVAIGENVQGWEIGDLAGIKWINGTCLNCEFCQNSNESNCAKADMSGY
THDGTFQQYATADAVHAARIPKGTDLASVSPILCAGITVYKALKTSGAKPGQWVAISGAA
GGLGSLALQYAKAMGFRVLAVDGGDKGEFVKSLGAESYVDFTKSKDVVKEISETTGGGPH
AVINVSVSVAAMNQSTEYVRSCGTVVLVGLPHAKLEAGIFNTVVKCVSIKGSYVGNRADS
AEAIDFFARGLIKCPIKVVGLSELASIYKLMEEGKILGRYVVDTSK
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgtccattccaaaaactcaaaaagctattatcttcgaaacctccggtggtgaattgaaa
tatgctgatattgcggttccaaagccaaaacctaacgaaattttaatcaatgttaagttc
tctggggtctgtcatactgacctccatgcatggaaaggagactggcctttaccaactaaa
ttgcctttggtaggtggacatgaaggtgcgggtgaagttgttgccattggtgaaaatgtc
caaggatgggaaatcggtgatttagcaggtatcaaatggatcaatggtacctgtttgaat
tgtgaattctgtcaaaactccaatgaatccaactgtgccaaagctgatatgtctggatac
acccatgacggtactttccaacaatacgccactgccgatgctgttcatgctgctagaatt
ccaaaaggaaccgacttagcttcagtttctccaattttatgtgctggtattactgtttac
aaagctttaaagacttccggtgcaaagccaggtcaatgggttgcaatttctggtgcagct
ggtggtttaggttccttagcgcttcaatacgctaaggccatgggtttcagagttttagca
gttgatgggggcgataagggagagttcgtcaagtccttaggtgctgaatcctatgttgac
tttaccaaaagtaaggacgttgttaaggaaattctggaaaccactggtggaggtcctcac
gctgttatcaacgtttctgtctcagtcgctgccatgaaccaatcgactgaatatgttaga
tcttgtggtactgttgtcttagtaggtttaccacatgctaagcttgaagctggtatcttc
aacactgttgttaaatgtgtttctatcaagggttcttatgtgggtaacagggctgattct
gctgaagcaattgacttctttgcaagaggccttattaaatgcccaattaaggttgttggt
ttatctgaattggctagtatctataaattgatggaagaaggtaagattttaggtagatac
gtcgttgatacctcaaaatga

DBGET integrated database retrieval system