KEGG   Debaryomyces hansenii: DEHA2F03938gHelp
Entry
DEHA2F03938g      CDS       T01026                                 

Definition
(RefSeq) DEHA2F03938p
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
dha  Debaryomyces hansenii
Pathway
dha00010  Glycolysis / Gluconeogenesis
dha00071  Fatty acid degradation
dha00350  Tyrosine metabolism
dha01100  Metabolic pathways
dha01110  Biosynthesis of secondary metabolites
dha01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:dha00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DEHA2F03938g
  Lipid metabolism
   00071 Fatty acid degradation
    DEHA2F03938g
  Amino acid metabolism
   00350 Tyrosine metabolism
    DEHA2F03938g
Enzymes [BR:dha01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     DEHA2F03938g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 TFX_C
Motif
Other DBs
NCBI-GeneID: 2903188
NCBI-ProteinID: XP_460537
UniProt: Q6BMN4
Position
F:353823..354863
Genome map
AA seq 346 aa AA seqDB search
MSIPKTQKAIIFETSGGELKYADIAVPKPKPNEILINVKFSGVCHTDLHAWKGDWPLPTK
LPLVGGHEGAGEVVAIGENVQGWEIGDLAGIKWINGTCLNCEFCQNSNESNCAKADMSGY
THDGTFQQYATADAVHAARIPKGTDLASVSPILCAGITVYKALKTSGAKPGQWVAISGAA
GGLGSLALQYAKAMGFRVLAVDGGDKGEFVKSLGAESYVDFTKSKDVVKEISETTGGGPH
AVINVSVSVAAMNQSTEYVRSCGTVVLVGLPHAKLEAGIFNTVVKCVSIKGSYVGNRADS
AEAIDFFARGLIKCPIKVVGLSELASIYKLMEEGKILGRYVVDTSK
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgtccattccaaaaactcaaaaagctattatcttcgaaacctccggtggtgaattgaaa
tatgctgatattgcggttccaaagccaaaacctaacgaaattttaatcaatgttaagttc
tctggggtctgtcatactgacctccatgcatggaaaggagactggcctttaccaactaaa
ttgcctttggtaggtggacatgaaggtgcgggtgaagttgttgccattggtgaaaatgtc
caaggatgggaaatcggtgatttagcaggtatcaaatggatcaatggtacctgtttgaat
tgtgaattctgtcaaaactccaatgaatccaactgtgccaaagctgatatgtctggatac
acccatgacggtactttccaacaatacgccactgccgatgctgttcatgctgctagaatt
ccaaaaggaaccgacttagcttcagtttctccaattttatgtgctggtattactgtttac
aaagctttaaagacttccggtgcaaagccaggtcaatgggttgcaatttctggtgcagct
ggtggtttaggttccttagcgcttcaatacgctaaggccatgggtttcagagttttagca
gttgatgggggcgataagggagagttcgtcaagtccttaggtgctgaatcctatgttgac
tttaccaaaagtaaggacgttgttaaggaaattctggaaaccactggtggaggtcctcac
gctgttatcaacgtttctgtctcagtcgctgccatgaaccaatcgactgaatatgttaga
tcttgtggtactgttgtcttagtaggtttaccacatgctaagcttgaagctggtatcttc
aacactgttgttaaatgtgtttctatcaagggttcttatgtgggtaacagggctgattct
gctgaagcaattgacttctttgcaagaggccttattaaatgcccaattaaggttgttggt
ttatctgaattggctagtatctataaattgatggaagaaggtaagattttaggtagatac
gtcgttgatacctcaaaatga

DBGET integrated database retrieval system