KEGG   Debaryomyces hansenii: DEHA2F04840gHelp
Entry
DEHA2F04840g      CDS       T01026                                 

Definition
DEHA2F04840p
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
dha  Debaryomyces hansenii
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:dha00514]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:436222..438519
Genome map
AA seq 765 aa AA seqDB search
MSSSGIYSGEKDALRRVGKSSTKNDTVDSINSLNENAAPDFDKLKRTQYDETKEFISSLK
FLESFLAPILFTILSFSVRLYKIGINEHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKML
IGLSGYLAGYNGSWDFPSGEMYPDYIDFTKMRIFNATFSALCVPLAYFTFKQIGFTIAST
WLFTLMVCLELSYVTLGKFILLDSMLLFFTVATVFCFTRFHNFNSDPNTKNFSRKWWKWL
LLTGFAIGCTCSVKMVGLFVTTLVGIYTITDLWNKFGDKTITWRKYSYHWIARVIGLIIV
PIIIFLISFKVHFDLLYKSGTGDANMSSLFQANLLGSDVVGGAREISIGHSVVTLKNQGL
TGGLLHSHIQTFPEGSKQQQVTTYTHKDTNNNWVFQRARGMEPYDTEKSQDIDYVLDGMV
VRLVHPMTGRNLHTHNIPAPISKSEWEVAGYGNLTLGDYKDNWVVEIMEQNGEEDKLRLH
PLTSSFRLRNTELDCYLGVSGNNLPAWGFRQGEVACYQNPFKKDKRTWWNIENNANKLLP
PSPPDFKLPKTRFLKDFIQLNLAMMATNNALVPDHDKQDDLASSAWQWPTLHTGIRMCSW
ADDKIKYFLIGSPATTWPSSIGVILFAFIVLFYLIRWQRQYNDFPDQQKLKLFTMGGIYP
MFGWGLHFMPFIIMGRVTYVHHYVPALYFAMMIFCYELELFTLPLRNSSSAISKLAYALI
FAAWYAIVIGTFWYWRHVSFGIEGPKEDWTHLDLLPSWRIANDNY
NT seq 2298 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcatctgggatatattctggagagaaagatgcactccgtagggtgggtaaatcc
tctactaagaatgataccgttgactctatcaattctttaaatgaaaatgctgctcctgat
tttgataaattgaaaaggactcaatatgacgaaacaaaggaattcattctgtctttaaag
tttttggaatctttcttagcaccaatccttttcaccatcttatcattcagcgttagatta
tacaaaattggaatcaatgaacacgttgtttgggatgaagcacattttggaaaatttggt
tcatactacttgagacatgaattctatcatgatgtgcacccacctttaggtaaaatgttg
attggtttatctggttacttagccggctacaatggttcatgggatttcccatctggtgaa
atgtaccctgactacattgattttacgaaaatgagaatcttcaatgctactttttcagct
ttgtgcgttcctttggcttattttaccttcaagcagattggtttcactattgcatcaacg
tggttatttacattgatggtttgcttggaactttcttatgttactttaggaaaattcatt
ttgttagactcaatgttacttttcttcacagtcgccacggttttctgttttacgaggttt
cacaactttaactcggacccaaatacaaaaaacttcagcagaaaatggtggaaatggtta
ttattgactggttttgcgattggatgtacatgttctgttaaaatggttggtttattcgtt
actacattagttggtatttataccatcactgacttatggaataagttcggagataaaact
atcacttggaggaagtattcttatcactggattgcaagagtaattggtcttatcatagtt
ccgatcattatctttttaattagttttaaagttcattttgatttattgtataaatctggt
acaggtgatgctaatatgtcctcattgtttcaggccaacttacttggttctgatgttgtt
ggtggtgcaagagaaatttcaattggccactccgttgttacattaaagaatcaaggtttg
actggtggtttattgcattcacatattcaaaccttcccagaaggttcaaagcaacaacag
gtaactacatacactcacaaagatacgaataacaactgggtgtttcaaagagcaagaggc
atggaaccatatgatactgaaaagtctcaagatatcgattatgttcttgacggtatggtt
gtaagattagttcatccaatgactggtcgtaatttgcatacccataatatcccagctcca
atcagcaagtcggaatgggaagttgcaggttacggtaacttgacacttggtgattacaag
gataattgggttgttgaaatcatggaacaaaatggtgaagaagacaaattgagacttcat
ccattaacctcttcatttagattaaggaacactgaattagattgttacttaggtgtatct
ggtaataatttacctgcttggggtttcagacaaggtgaagttgcctgttatcaaaatcct
tttaagaaagataagagaacttggtggaatattgaaaacaatgccaataagttgttacct
cctagtcctcctgatttcaaattaccaaaaaccagattccttaaggatttcattcaattg
aatttggcaatgatggcaaccaataatgctttagttcctgaccatgacaagcaagatgat
ttggcttcatctgcttggcaatggccaacgttacacacaggtattagaatgtgttcatgg
gctgatgataaaatcaaatacttcttaattggttctcctgctactacctggccttcctct
attggtgtgattctctttgcttttattgtattattctacttgatcagatggcaaagacaa
tacaatgacttcccagatcaacaaaaattgaaattgttcactatgggtggtatttatcca
atgtttggatggggcttacattttatgccatttattattatgggtagagttacttatgtt
catcattacgttccagccctttacttcgcaatgatgattttctgctatgagttagaatta
ttcaccttaccattaagaaattcttcatctgcgatcctgaaattggcatatgcattaatt
tttgccgcatggtatgctatagttattggaaccttctggtactggagacatgtttctttc
ggtatagaaggtcctaaggaagactggacccatttggatttattaccatcttggagaatt
gcaaatgataactattag

DBGET integrated database retrieval system