KEGG   Debaryomyces hansenii: DEHA2F06446gHelp
Entry
DEHA2F06446g      CDS       T01026                                 

Definition
DEHA2F06446p
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
dha  Debaryomyces hansenii
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:dha00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    DEHA2F06446g
Enzymes [BR:dha01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     DEHA2F06446g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:complement(566430..569084)
Genome map
AA seq 884 aa AA seqDB search
MYKSGLRAAFKPPRRIDSSQSSLDAKSSSPAPINQCVDAKVSQDKEASPYRAASSESSRQ
AYKRPKIGSNVMKAEDSPSVLAPGPKDEESVRMYMVQWRKFTNKKNKTWDGDGLIVVSSS
GITFKCDVKGNGNYKQMGKTSKTKTEGIIALGSYELEIDYEIADKTTLNNSQDVGQENKV
PSHHIPAPPRNQFKKVVPLGISNAQSTARVSTSNRNPLYDPDAEHSLIMTRPPNKTREET
IDVVVDPVLSRLLRPHQREAVSFVYECLMGFKNFKGNGALLADEMGLGKTLTTITLIWTL
LKQTPYSEDISPICKKVLITCPVTLIGNWKKEFKKWLNINRIGVLTVNNKQNASKDKQEI
KSFGKTRIYQVLIMSYEKVLSCQNELSTIDFDMLVCDEGHRLKNSSNKVLKVLNDMNISK
KVLLTGTPIQNDLVEFYNIINFINPSVLGSFQSFQKDFIKPILRSREVNCINKDTIKRGE
IKSNELIELTKEFTLRRTSSILSGYLTEKTDIILFCPPTELQIALFKFVLDSKKFNALLR
EDNNSLTLITLFKKICNSPSLLFQDKLFNSLIENEHDSTIDLTTLSKKTASSKVNILIPL
LIEINQIGDKTVLISNYTQTLDLLETILHKLNISFSRLDGSTPNKLRDKLVNDFNKQPVS
TNSVFLLSAKSGGVGLNLIGASRLILFDNDWNPSIDLQAMARIHRDGQTKPVFIYRIMTT
GCIDEKIFQRQMMKNNLSDKFLDNKTDSKSNLFDMNDLKDLFTVNEETLSNTHDLLQCDC
SGIGEDINPLSIDIDSDDADEETNNPGGWITALDYKQEDQKPKRQQASMINALIDYKHYN
PVNVSEQLDCGDMVTKNIIQKSKERSMPIPITYMLTKVTNCTSV
NT seq 2655 nt NT seq  +upstreamnt  +downstreamnt
atgtataaatcaggattaagagcagcattcaagccaccacggcgtattgatctgtctcaa
tcgtcattagacgcgaaatcaagctctcctgccccaattaatcaatgtgttgatgccaaa
gtatcgcaagataaagaagccagtccttatcgcgcagcatccagcgagctgagccgccag
gcatataaaaggccgaaaattggctcaaatgtcatgaaagctgaagactcgcccagtgtt
ttagcgcctggtcccaaagatgaggaatcggtaaggatgtatatggttcaatggagaaag
ttcaccaataagaagaataaaacgtgggatggagatggcttaatagtcgtcagtagttcg
ggtattacattcaaatgcgatgtcaaaggcaatggaaattataagcaaatggggaaaacg
tcgaagaccaagactgagggaatcatcgcattagggtcctacgaactagaaatagattac
gagattgcagacaaaacaaccctaaacaattcccaagacgtaggtcaagaaaataaagtt
cccctgcatcatattccagcgccgcctagaaaccagtttaagaaggtagtccccctagga
atatcgaatgcacagagtactgctagagtttcaacgagcaaccgaaaccctctttatgat
cctgacgcagagcattctcttattatgaccagaccacccaataaaacgcgtgaagaaact
attgatgtggtagtcgaccctgttctttcaagattgctaagaccccaccaacgtgaagca
gtttctttcgtctacgagtgcttaatgggattcaagaatttcaaaggaaatggtgcttta
ctcgctgacgaaatgggtttgggaaaaacccttaccacaattacactcatatggacccta
ctaaaacaaaccccttattctgaagatatatctccaatttgtaagaaggtattaattact
tgtcctgtcacattaattggtaactggaaaaaagaattcaagaagtggttaaacatcaat
aggattggtgttctcactgtaaacaataaacaaaatgcaagcaaggataaacaggaaatt
aaaagttttggtaagactagaatatatcaagtcttaataatgagctacgaaaaggtctta
tcatgtcaaaatgaattatcaactatcgactttgatatgctagtctgtgatgaaggtcac
aggcttaagaatagctcgaataaggttttgaaagtccttaatgacatgaatatatcaaaa
aaggttttgcttacaggaacgccaatacagaatgatttggtagaattttataatattata
aattttataaacccttctgtattgggttcgttccaatctttccaaaaggatttcattaag
ccaattctcagatcaagagaagtaaactgtattaataaagatacaataaaacgaggagaa
atcaaatctaacgagctaatcgaactaactaaagagtttacattgcgtcgtactagtagt
attctttcgggttatttgacagaaaagactgatatcattttattttgtccgcccactgaa
cttcagatagcgttatttaaatttgtattggattctaagaaatttaatgcattgctaaga
gaagataataactcgttgactttgataactttgttcaagaaaatttgcaattctccgagt
ttattgtttcaagataaactatttaactcgttaatagagaatgaacacgattctactatt
gatttaaccacgttgtcgaaaaagactgcaagtagcaaagtcaacattctaataccttta
ctaattgagattaatcagattggtgataagacagtacttatatctaattatacacaaact
ttagatttacttgaaactattttacacaagctaaatatatcattcctgagactagatggc
tcaactccaaataaattacgggataagctagttaatgatttcaataagcaacctgtactg
acgaattcagttttcttattatccgcaaagtctgggggagtaggattgaacttaatcgga
gcatcaagactaattctttttgataatgattggaacccatcgattgatttacaggcaatg
gcacggatccatcgagatggacaaacaaagcctgtatttatttatagaattatgaccaca
ggttgtatcgatgaaaaaatcttccaacgtcaaatgatgaagaataacctaagtgataaa
ttcttggataacaaaaccgattcaaaactgaatttatttgatatgaatgacttgaaagat
ttattcacagttaatgaagaaacgttatctaacacgcatgatttattgcaatgtgactgt
tctggcataggagaagatatcaatcctctttcaattgatattgattcggacgatgccgat
gaagaaactaataaccctggaggctggattacagcattggattataaacaagaagatcaa
aaaccgaaaaggcagcaggctagtatgatcaatgctttaattgattataagcattataat
cctgttaatgtatctgagcagctagattgtggtgacatggttacaaaaaatataattcag
aagtcaaaggagagatcaatgccaataccaattacatatatgcttactaaagttacaaat
tgcacatcagtatag

DBGET integrated database retrieval system