KEGG   Debaryomyces hansenii: DEHA2F06754gHelp
Entry
DEHA2F06754g      CDS       T01026                                 

Definition
(RefSeq) DEHA2F06754p
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dha  Debaryomyces hansenii
Pathway
dha00010  Glycolysis / Gluconeogenesis
dha00051  Fructose and mannose metabolism
dha00562  Inositol phosphate metabolism
dha01100  Metabolic pathways
dha01110  Biosynthesis of secondary metabolites
dha01130  Biosynthesis of antibiotics
dha01200  Carbon metabolism
dha01230  Biosynthesis of amino acids
Module
dha_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
dha_M00002  Glycolysis, core module involving three-carbon compounds
dha_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dha00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DEHA2F06754g
   00051 Fructose and mannose metabolism
    DEHA2F06754g
   00562 Inositol phosphate metabolism
    DEHA2F06754g
Enzymes [BR:dha01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     DEHA2F06754g
Exosome [BR:dha04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   DEHA2F06754g
  Exosomal proteins of bladder cancer cells
   DEHA2F06754g
  Exosomal proteins of melanoma cells
   DEHA2F06754g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 2904121
NCBI-ProteinID: XP_460653
UniProt: Q6BMB8
Position
F:complement(597317..598063)
Genome map
AA seq 248 aa AA seqDB search
MARQFFVGGNFKMNGTRESVSKIVDGLNKAELPSNVEVVIAPPAPYIALAVNENKQKTIE
VSAQNCFDKASGAYTGEISPEQIKDLGATWTLTGHSERRTIIKESDDFIASKTKFALDQG
LSVILCIGETLEERKANVTLDVCARQLDAVARVVSDWSKIVVAYEPVWAIGTGLAATPED
AQETHKAIREHLSKSIGADAAEKTRILYGGSVNGKNAPEFKDKADVDGFLVGGASLKPEF
VDIIKSRL
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtcaattctttgttggaggtaactttaaaatgaacggtactagagaatccgtt
tccaagatcgtggatggtttaaacaaggccgaattaccatcaaatgttgaagttgtcatt
gctccaccagcaccatacattgctttagctgtcaacgaaaacaagcaaaagactatcgaa
gtttctgctcaaaattgtttcgacaaggcttctggtgcttacactggtgaaatttcccca
gaacaaattaaagatttaggtgccacctggactttaactggtcactctgaaagaagaact
atcatcaaggaatctgatgacttcattgcttcaaagaccaagttcgctttagatcaaggt
ttatctgtcatcttatgtattggtgaaaccttagaggaacgtaaggctaacgttacctta
gatgtatgtgctagacaattagacgctgttgccagagttgtctctgactggtctaagatt
gttgttgcctacgaaccagtctgggctattggtactggtttagctgctactccagaagat
gctcaagaaactcacaaggctatcagagaacacttatctaagtccattggtgctgatgct
gctgaaaagaccagaatcttatacggtggttctgtcaacggtaagaatgctcctgaattc
aaggacaaggctgatgtcgatggtttcttagtcggtggtgcttctttaaagccagaattt
gttgacatcatcaagtcaagattgtaa

DBGET integrated database retrieval system