KEGG   Debaryomyces hansenii: DEHA2F08008gHelp
Entry
DEHA2F08008g      CDS       T01026                                 

Definition
(RefSeq) DEHA2F08008p
  KO
K01074  palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
dha  Debaryomyces hansenii
Pathway
dha00062  Fatty acid elongation
dha01100  Metabolic pathways
dha01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:dha00001]
 Metabolism
  Lipid metabolism
   00062 Fatty acid elongation
    DEHA2F08008g
Enzymes [BR:dha01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     DEHA2F08008g
Lipid biosynthesis proteins [BR:dha01004]
 Fatty acid synthase
  Component type
   DEHA2F08008g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Palm_thioest DUF676 PGAP1 Lipase_2 Adeno_E4
Motif
Other DBs
NCBI-GeneID: 8998914
NCBI-ProteinID: XP_002770771
UniProt: B5RUB9
Position
F:complement(692851..693864)
Genome map
AA seq 337 aa AA seqDB search
MHIGHLLLKALSLQKFASEIVLENTTPGIPKVQTNLKYSPQYVEVDLIPENEQEVYKING
RRPLVIWHGLGDNYNSSGMVDVVSIFNQRYPDMFIYPIFLDAKPSKDQEKTLFGDANKEV
EYVCEQLSAIPELKEGFDAIGFSQGGLFMRALVQRCSSVSVNNLITFGSPHMGVSELPMC
KPNDWLCKRKNAILKRQVWHENIQKSIIPAQYFRDPYEYDNYVSHSNFLADVNNELAQKS
NPAYAKNLNKLSKFVMVVFTKDTTLVPKESAGFNDWDTIYDKTIPFDKTSLYENDLLGLR
TMNENGKLAFLEIEEDHMVISDTFLVDIAENYVGGSL
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgcatataggtcatcttctattgaaagctctatcactacaaaaatttgcttcagaaatc
gtccttgagaatacaacgcccgggataccaaaggttcagacaaatttgaaatattcccca
caatatgttgaagtagacttaatacctgaaaatgaacaggaagtatataagattaatgga
cgtcgaccattagttatatggcatggacttggtgataattacaattcatcgggaatggta
gatgtagtatccatattcaaccaacggtatcctgatatgtttatatatccaatttttcta
gatgcaaaaccttctaaagaccaggagaaaacattattcggagatgcaaataaagaagtg
gaatatgtgtgtgaacaattatcagctatccccgagttgaaggaagggttcgatgcaatc
ggattttctcagggagggttatttatgagggcattggtacagcgatgttccagtgtatcg
gtgaacaaccttataacatttgggtcaccacatatgggtgttctggaacttcctatgtgt
aaacctaatgactggttgtgtaaaaggaagaatgcaattcttaaaaggcaggtgtggcat
gaaaatatacagaaatctataatacctgctcagtatttccgggacccttacgaatatgat
aactatgtatcccattcgaatttcttagcagatgtaaacaatgagttggctcaaaaatct
aatccagcctatgcaaagaatcttaacaaattaagtaagttcgttatggttgttttcacg
aaggataccactctagttcccaaagagagtgctggtttcaatgattgggatacaatttat
gataagaccataccatttgataaaacatcattgtatgagaatgatttgctagggcttaga
actatgaacgagaatgggaagcttgcattcttagagattgaagaagatcatatggttata
tcagatacgtttttagttgatattgctgagaattacgtaggtggatcattgtga

DBGET integrated database retrieval system