KEGG   Debaryomyces hansenii: DEHA2F08008gHelp
Entry
DEHA2F08008g      CDS       T01026                                 

Definition
DEHA2F08008p
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
dha  Debaryomyces hansenii
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:dha00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    DEHA2F08008g
  Lipid metabolism
   00062 Fatty acid elongation
    DEHA2F08008g
Enzymes [BR:dha01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     DEHA2F08008g
Lipid biosynthesis proteins [BR:dha01004]
 Fatty acid synthase
  Component type
   DEHA2F08008g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:complement(692851..693864)
Genome map
AA seq 337 aa AA seqDB search
MHIGHLLLKALSLQKFASEIVLENTTPGIPKVQTNLKYSPQYVEVDLIPENEQEVYKING
RRPLVIWHGLGDNYNSSGMVDVVSIFNQRYPDMFIYPIFLDAKPSKDQEKTLFGDANKEV
EYVCEQLSAIPELKEGFDAIGFSQGGLFMRALVQRCSSVSVNNLITFGSPHMGVSELPMC
KPNDWLCKRKNAILKRQVWHENIQKSIIPAQYFRDPYEYDNYVSHSNFLADVNNELAQKS
NPAYAKNLNKLSKFVMVVFTKDTTLVPKESAGFNDWDTIYDKTIPFDKTSLYENDLLGLR
TMNENGKLAFLEIEEDHMVISDTFLVDIAENYVGGSL
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgcatataggtcatcttctattgaaagctctatcactacaaaaatttgcttcagaaatc
gtccttgagaatacaacgcccgggataccaaaggttcagacaaatttgaaatattcccca
caatatgttgaagtagacttaatacctgaaaatgaacaggaagtatataagattaatgga
cgtcgaccattagttatatggcatggacttggtgataattacaattcatcgggaatggta
gatgtagtatccatattcaaccaacggtatcctgatatgtttatatatccaatttttcta
gatgcaaaaccttctaaagaccaggagaaaacattattcggagatgcaaataaagaagtg
gaatatgtgtgtgaacaattatcagctatccccgagttgaaggaagggttcgatgcaatc
ggattttctcagggagggttatttatgagggcattggtacagcgatgttccagtgtatcg
gtgaacaaccttataacatttgggtcaccacatatgggtgttctggaacttcctatgtgt
aaacctaatgactggttgtgtaaaaggaagaatgcaattcttaaaaggcaggtgtggcat
gaaaatatacagaaatctataatacctgctcagtatttccgggacccttacgaatatgat
aactatgtatcccattcgaatttcttagcagatgtaaacaatgagttggctcaaaaatct
aatccagcctatgcaaagaatcttaacaaattaagtaagttcgttatggttgttttcacg
aaggataccactctagttcccaaagagagtgctggtttcaatgattgggatacaatttat
gataagaccataccatttgataaaacatcattgtatgagaatgatttgctagggcttaga
actatgaacgagaatgggaagcttgcattcttagagattgaagaagatcatatggttata
tcagatacgtttttagttgatattgctgagaattacgtaggtggatcattgtga

DBGET integrated database retrieval system