KEGG   Debaryomyces hansenii: DEHA2F09350gHelp
Entry
DEHA2F09350g      CDS       T01026                                 

Definition
DEHA2F09350p
Orthology
K11423  
histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
dha  Debaryomyces hansenii
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:dha00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    DEHA2F09350g
Enzymes [BR:dha01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     DEHA2F09350g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:806287..808482
Genome map
AA seq 731 aa AA seqDB search
MSDMEELDVKAKQYTPQLFLESEDKTDEARSTFNELQECTYSSKSTGSSGQHEHMTCDCY
EDWDSDKQQNMACGEDSDCINRVTSVECSNKFCTCGNDCQNQRFQKKQYANVTVIQTELK
GYGLRANEDISESSFIYEYIGEVIDEESFRKRMIDYDTKKLIHFYFMMLKKDSFIDATMK
GSLARFCNHSCNPNAYVDKWVVGEKLRMGIFSKRNIQKGEEITFDYNVDRYGAQSQPCYC
GEPNCIKWMGGKTQTDAALLLPDGISEALGVTHKQERQWLKENKHLRSKQQSDESIINEA
FVKSIEVSALTESDVSKVMGALMRVQDLNITQKLIERIYLTSDDSINSSIIRVHGYKTLS
QTIKAFKDEDKELISKILIILAKWPKVTRNKISSSQIEDVVKDINTNSNDDNLKKLSSDL
LAEWGKLQMAYRIPKNIGNDKESNSPALYGRNARSRSRSRSPDRGKSAEPQHVETDEALP
DGWQTAFDPNTQTNYYYHAELGISKWERPIKEVPKGPKGPKALPVSEPIQRPNSNSNGRS
YNEEELTRREEERLKREKEEQFKEIQQKERLLQELILQSQKELEEKKSFEEKMKLEKLEK
EKERQALKRKKLKKSKSSIPPAPPVPIDGQWTKTFAKHVPNFLKKYEAEIGRDNIKGCAK
ELVKTLVAKEMKKNPDTKPPKELDNAKLKKIKEYSKMFMDKFLIKYRSKHDKKRSHNEEN
GGTKRVKPDVE
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatatggaagaattggatgtcaaagccaaacagtacactcctcagctattttta
gagtctgaggacaagacggacgaggctagaagtacatttaatgaacttcaagaatgcaca
tactcttctaagagtactggttcctccgggcaacatgaacatatgacttgtgattgttat
gaagattgggattcagataagcaacagaatatggcttgtggtgaagattcagactgtatc
aatagagtaacttcagtcgaatgtagtaataaattttgtacatgtggaaatgactgtcag
aaccagagatttcaaaaaaaacaatacgctaatgtaactgttattcaaactgagttgaaa
ggatatggtttgagagccaatgaagatatttccgaatcaagctttatatacgaatatata
ggtgaggtgattgatgaagaaagcttcaggaagagaatgattgattatgatactaaaaag
ttgatacatttttattttatgatgttgaaaaaggattcattcattgatgcaactatgaaa
ggttcgttagctcgtttttgtaaccattcgtgtaacccaaatgcatatgttgataaatgg
gttgttggtgaaaaattaagaatgggtatattttccaagagaaatattcaaaaaggcgaa
gaaatcacattcgactataacgttgatagatatggtgcacaatctcaaccatgttattgc
ggtgaaccaaattgtataaaatggatgggtggaaaaactcagactgatgctgcgttatta
ttgcctgatggaatctctgaggcactaggtgttactcataagcaagaaagacaatggttg
aaggaaaataaacatcttagatccaaacaacaaagtgacgaatcaattattaacgaagca
tttgttaagtctatagaggtttcagccttaaccgaaagtgatgtttcgaaggtaatgggt
gctttgatgagggttcaagatttaaacataactcagaaattgatagagaggatatacttg
actagcgatgacagtataaactcctcaattataagagttcacggttataaaactttatca
caaaccattaaagcatttaaagatgaagataaggagctaataagcaaaatattaattatc
ttagccaaatggccaaaggttacacgtaacaaaatctcgtcatcccagattgaggatgta
gttaaagacatcaataccaatagtaatgacgacaacttaaaaaagttatcatctgattta
ctagctgaatggggtaagctacaaatggcatatagaattccaaagaatattggtaatgat
aaagaatcaaactcgcctgcattgtacggtagaaatgccagatctagatccagatccaga
tcaccggatagaggaaaatctgccgagcctcagcatgtggaaaccgacgaggcattacca
gatggttggcaaacggcatttgaccctaacactcaaactaattactattaccatgcagaa
ttaggaatttctaaatgggaaagaccaattaaggaagttccaaaaggtccaaagggtccg
aaagctttaccagtcagcgagcctatacaaagacctaatctgaacagcaatggaaggagt
tataatgaagaggaactcactaggagagaagaagaaaggttgaaaagagaaaaagaggaa
caatttaaagaaattcaacagaaagaaagacttttacaagaattgatccttcaatctcag
aaagagctagaagagaaaaaatcgtttgaagagaagatgaagctagaaaaacttgagaaa
gaaaaagaaagacaagcgcttaaacgtaaaaagctcaaaaagtccaagtcatctatacca
ccagcaccaccagttccaattgacggacaatggacaaaaacatttgctaagcatgttcct
aactttctcaagaaatatgaagcggaaattggtagggataatatcaaaggatgtgcgaaa
gagttagtgaaaactttagtagctaaggaaatgaaaaagaatccagatactaaacctcct
aaagaattagataatgcaaaattaaagaaaataaaggaatactcgaagatgttcatggat
aaatttttgattaaatatagatccaagcatgataagaagagaagtcataatgaagaaaat
ggaggaaccaagagggtgaaacctgatgtcgaatag

DBGET integrated database retrieval system