KEGG   Debaryomyces hansenii: DEHA2F09526gHelp
Entry
DEHA2F09526g      CDS       T01026                                 

Definition
DEHA2F09526p
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
dha  Debaryomyces hansenii
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:dha00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    DEHA2F09526g
  Metabolism of other amino acids
   00480 Glutathione metabolism
    DEHA2F09526g
Enzymes [BR:dha01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     DEHA2F09526g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:818927..819409
Genome map
AA seq 160 aa AA seqDB search
MSFYDLSPLDTNDKPFPFEELKGKVVLVVNVASKCGFTPQYKELEELNKKYQDKGLQIIG
FPCNQFGGQEPGSSEEIASFCSLNYGVSFPVLKKVDVNGDKTDPVYKYLKGEKSGLLGLN
RIKWNFEKFLIDKNGKVIERYSSLTKPASLSSTIEELLKK
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgtctttttacgatttaagtcctcttgatacaaacgacaagccattcccatttgaagaa
ttaaagggtaaagttgtgttggtggtcaatgttgcatctaagtgtggtttcacaccacaa
tacaaggaattagaagaactcaacaaaaaatatcaggataaaggattacagattattggt
ttcccatgtaaccaattcggaggacaagaaccgggcagttctgaagaaattgctagcttc
tgttctctcaactacggagtgtcattcccagtgttgaagaaagtcgatgtcaatggggac
aagactgacccagtttacaagtatttgaagggggaaaagctgggattactcgggttgaac
agaattaagtggaactttgaaaaattcttgattgacaagaacgggaaggttattgaacgt
tattcgtcattgaccaagcctgcttctctcctgtctacaatcgaggagttattgaagaaa
tag

DBGET integrated database retrieval system