KEGG   Debaryomyces hansenii: DEHA2F09768gHelp
Entry
DEHA2F09768g      CDS       T01026                                 

Definition
DEHA2F09768p
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
dha  Debaryomyces hansenii
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:dha00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    DEHA2F09768g
Translation factors [BR:dha03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    DEHA2F09768g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:839775..841934
Genome map
AA seq 719 aa AA seqDB search
MNDNMSEQEYRSLEKEVQLDDLDFSDLEAKYAVNSDFGMDNYVVVDGAPIAPEAKVPILI
KVLKKLFNTVGEVVEGDEGIHMPLQDGKSKGYLFVQFKTPQMAEAAIQQLHGKKLDQKHR
LLVNKLSDIEKFGAEGNVEIDFHEPEIPPFKSHGYLRSWLQDEQGRDQMALHFSETVGVY
YNKKKNDPEPVIEPRKGFTSKYAKFSPLGTYLFSVHPQGVQSWGGDGFQSITKFIHNQVR
LIDFSPNEKYMVTLSPLPIALPDDPAERSIFPFGPESNGHKLVIWDMATGEPARTFALPP
HLEGQKDMPWPLVKWSHDDKYCARQGPGALAIYETPSFQLLDKKLVKVDDVVDFEWAPAA
VHLSDSKVKEGEYILSYWTPESSNQTARVALMQIPSRKVIRTINLFQVSDCKMHWHGEGK
FLCVKVDRHTKSRKTFFSNLEFFKVTEKDIPVEKLELKDVVFNFAWEPRSERFITISRLD
DGNQNPSIAKNTISFYAPQVSSKGRVTSSKYTCFKEIHDKHSNTVCWSPKGRFVVVATIS
KSSGELEFYDCSYEEDKPANSKVNGNVKLLKAEKYSGMTNLAWDPSGRFVAAWSSSWAHS
IENGYRLFEFTGNMLKDNSIDHFKEFIWRPRPASLLNAADRKKVRKNLREYSAQFDEADA
MEADAASREAILLRRKLLEQWRSYRAKHAANGSKKNEVQAEIIEEIKEEIIEEKEEVVE
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgaacgataatatgtctgaacaagagtataggagtctcgagaaagaggtccaattagat
gaccttgacttctctgacttggaagccaagtacgcagttaattctgattttggtatggat
aattatgttgttgtcgatggtgctccaattgctccagaggctaaagttcctattttaatc
aaggttttaaagaaattattcaacactgttggtgaagttgtcgaaggtgacgaaggaatc
cacatgccattacaagatggtaagtccaagggttatttgtttgttcaatttaagactcct
caaatggcagaagctgctatccaacaattgcacggcaagaaattagatcaaaagcacaga
ttgttagtcaacaaattaagtgatattgaaaagtttggtgcagaagggaatgttgaaatt
gatttccatgaacctgaaattccaccattcaagagtcatggttatttgagatcgtggtta
caagatgagcaaggtcgtgatcaaatggctttacacttttctgaaactgttggtgtttat
tataacaagaagaagaatgacccagaacctgttattgaaccaagaaagggatttacttcc
aaatatgctaaattctctccattaggtacatatttgttttccgttcacccacaaggtgtc
caatcatggggtggtgatggttttcaaagtattactaagtttatccataatcaagttcgt
ttaattgacttttctccaaacgaaaagtacatggttactttatccccacttccaattgcc
ttaccagatgatccagcagagagatctattttcccgttcggcccagaaagtaatggtcat
aaattagtcatttgggatatggcaactggtgaacctgctagaacttttgcattaccacca
catttagaaggtcagaaggatatgccatggccattagtcaaatggtcgcatgacgacaaa
tactgtgcccgtcaaggacctggcgctttagccatttatgaaactccatcattccaatta
ttagacaagaaattagtcaaggttgatgatgttgttgactttgaatgggctccagccgcc
gttcatctttctgactctaaggtaaaagaaggtgagtacattttgtcgtactggactcct
gaaagttctaatcaaacagcaagagttgccttgatgcaaattccatctagaaaagttatt
agaaccatcaatttattccaagtcagtgattgtaagatgcactggcatggtgaaggtaag
ttcttgtgtgttaaggttgatcgtcataccaaatcccgtaagacatttttctctaattta
gaattctttaaagttaccgaaaaggatattccagttgaaaaattagagttgaaggatgtt
gttttcaactttgcatgggaaccaagatcagaaagattcatcactatttccaggttagat
gatggtaatcagaatccatctattgccaaaaatactatttccttctacgcaccacaagtc
ctgtcgaagggtagagttacaagctcgaaatacacatgtttcaaggaaatccatgataag
cattctaacacagtttgctggtctccaaagggtagatttgttgttgttgctacaatttct
aagtctagtggtgaattggaattttatgattgctcatatgaagaagataaaccagctaac
agtaaagtcaacggtaatgttaaattattaaaagcagaaaaatactctggtatgacaaac
ttagcatgggatccatcaggaagatttgtcgctgcttggtcttcatcttgggctcattct
atagaaaatggttatagattatttgaattcactggtaatatgttgaaggataacagtatt
gaccatttcaaggaattcatctggagaccaagaccagcttctttattgaatgctgctgac
agaaaaaaggtcagaaagaacttacgtgaatatagtgctcaatttgatgaagctgatgcc
atggaggctgatgccgctagtagagaagctatcttattacgtcgtaagttgttagaacaa
tggagatcttacagagcaaagcatgctgctaatggttcaaagaagaatgaagtccaggct
gaaatcattgaggaaatcaaagaagaaatcattgaagaaaaagaagaagttgttgagtag

DBGET integrated database retrieval system