KEGG   Debaryomyces hansenii: DEHA2F12034gHelp
Entry
DEHA2F12034g      CDS       T01026                                 

Definition
DEHA2F12034p
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
dha  Debaryomyces hansenii
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:dha03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:complement(join(1029068..1030330,1030383..1030400))
Genome map
AA seq 426 aa AA seqDB search
MPEVAEVAHVCALMRRNLLGFRISKVKMNNDPLLFPFLKNNPNAEQELADLQSKLTGSTV
KSVGRHGKYFWLRLSLNKESKDETGVLLMHFGMTGMIKIRNVKSHLIFMENGGDKKVLKR
LEEEKKSTGAQSKYFKKEENDEAKSSDGDSSLLEPSKNNTDIKSEDTKEIEGMNEPDEEE
WPPRFVKFEMELQTENERFDLAFVDPRRLGKVRFLSGPLVQSDNDLMKQDPLSALGPDYS
KPLEISRTEFTTGDPDPDNHGKCRLSLEEFNKLILSKKKPIKSLLLEQEFFAGVGNWVGD
EIIYHARIHPNEVLSSKIPKGDSVDSIIERLYNSLLYVCELSVRVEGDVSQFPSNWLMIY
RWGKRRKNSPKPKTDEGYEVDHVTVGGRTSCFVPKLQKMIRKSAASEIRDTKELETEEKP
RKRRKV
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaagtagcagaagttgcccatgtgtgtgcgttgatgaggagaaatctacttgga
ttcagaatttcgaaagttaagatgaataatgatccactcctatttccttttttgaaaaac
aatcccaatgcagagcaagaattggctgatttacagtcgaaattaacaggttccactgtt
aagtctgttgggcgacatggaaaatacttttggttacggttgagccttaacaaagaatca
aaggatgaaactggtgttttattgatgcattttggaatgacaggcatgattaaaattagg
aacgtcaaatcccacttaatatttatggaaaatggaggtgacaagaaagtgttgaagagg
ttggaagaggagaaaaagtcaactggggctcaatcgaagtatttcaagaaagaggagaat
gacgaggccaaatcgtcggatggagacagctcattattagagcctctgaaaaataataca
gatataaaactggaggacaccaaagaaatcgagggaatgaatgaacccgatgaggaagaa
tggccacccaggtttgttaaattcgaaatggaattgcaaacagaaaacgagagattcgat
cttgcttttgttgatccacgaaggttaggtaaagtgaggtttctatctggtccattggtt
caatcagataatgatttaatgaaacaagatccattgtcagcgttggggcccgattattca
aaaccacttgaaatatccaggacagaatttaccaccggagatcccgatcctgacaaccat
ggaaaatgtagattatctcttgaggaatttaacaaattaatattgtccaagaaaaagcct
attaaaagcttattacttgagcaggagttttttgctggtgtgggaaattgggtaggtgac
gagattatctaccacgccaggattcatcccaatgaagtgttgagcagtaaaataccaaaa
ggggattcagtggatagtataatcgaaagactatacaactcattattatatgtatgtgag
ttgagtgtccgcgtagaaggagatgtttctcagtttccttcaaattggctcatgatttat
agatggggtaagagacggaaaaatagtcccaaaccgaagactgatgaagggtatgaggtt
gatcatgtcacagttggcggaagaacaagttgttttgtcccaaaattacaaaagatgata
cgcaaactggctgcatccgaaattcgggataccaaggaattggaaaccgaagaaaaacca
agaaagagaagaaaagtgtag

DBGET integrated database retrieval system