KEGG   Debaryomyces hansenii: DEHA2F17754gHelp
Entry
DEHA2F17754g      CDS       T01026                                 

Definition
DEHA2F17754p
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
dha  Debaryomyces hansenii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:1498921..1500003
Genome map
AA seq 360 aa AA seqDB search
MSTAAFKRQSVPLSKLFQSYGKNNSQSKYGGYFLATLIGSGILATSYFNNNKNGNTPSNN
HKKLLAGSGIVNTAAIPKGKSIKDYQSLYNEIAEKVRDQDDADDGAGRYGLLTRLAWHTS
GTYKKEDNTGGSYGGTMIYKPESTDGENSGLNHGRDFLQEFKDKYSWLSHGDLWTLGGVV
AVQECGGPKIKWRPGRQDISDKTRVPENGRLPDASKDADYVKGVFGRMGFNERETVCLIG
AHCLGKCHKENTNYDGPWGPSFNMFTNDFFVRLLQNWHVKKWDGKKQYEDDETNSFMMLP
TDMALKEDSSFLKYVKMYADDEKLFFSDFAKNFSTLLELGVTFPDSIKPTEFKTLDEQDK
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgtctacggctgcattcaaaagacaaagcgttccactttcaaaactcttccagagttat
gggaaaaacaattcacaatccaagtacgggggttacttccttgctacattaattgggtct
ggtattttggctactagttatttcaacaataataagaatggcaacacaccttcaaacaat
cacaaaaagttattagctggctctggtattgttaatactgcggccattccaaagggcaag
tcaatcaaggactatcaaagtctttataatgagatagccgaaaaggtcagagaccaagat
gatgcagatgatggtgctggtcgttatggtttacttacacgtctcgcatggcacacaagt
ggtacttacaagaaagaggataacacgggggggtcatacggtggtaccatgatctataaa
cctgaatcgactgatggcgaaaactctggattgaatcatggaagggatttcttgcaagag
tttaaggataagtattcctggttgagccatggtgatttatggactttaggtggagtagtt
gcagtccaagaatgtggaggaccaaaaatcaaatggagaccaggtcgtcaagatatcagt
gacaagacaagagttccagagaatggtagattaccagatgcttctaaagacgctgattat
gtgaagggtgtatttggaagaatggggttcaatgaacgtgaaactgtgtgtttaattggt
gctcattgtttaggtaaatgtcacaaggaaaacaccaactacgacggcccatggggacct
tccttcaacatgtttacaaatgacttctttgtaagattattgcaaaactggcacgtcaaa
aagtgggatggtaagaaacaatatgaagatgacgaaaccaactcgtttatgatgttgcca
acagacatggccttgaaggaagactctagcttcctcaagtacgtcaaaatgtatgccgat
gacgaaaagttattcttcagtgactttgccaaaaatttcagtactttacttgaattgggt
gttacattccccgactccattaaaccaactgaattcaaaacgttagatgaacaagataag
taa

DBGET integrated database retrieval system