KEGG   Debaryomyces hansenii: DEHA2F18304gHelp
Entry
DEHA2F18304g      CDS       T01026                                 

Definition
DEHA2F18304p
Orthology
K11252  
histone H2B
Organism
dha  Debaryomyces hansenii
Brite
Exosome [BR:dha04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   DEHA2F18304g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:1542798..1543187
Genome map
AA seq 129 aa AA seqDB search
MAPKAEKKPASKAPAEKKPAAKKTATSGTKKRSKTRKETYSSYIYKVLKQTHPDTGISQK
AMSIMNSFVNDIFERIAGEASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTRA
VTKYSSAAN
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atggccccaaaagctgaaaagaaacctgcctcaaaagccccagctgaaaagaaacctgct
gctaagaagactgctacttctggaaccaagaagagatctaagaccagaaaggaaacttac
tcttcttacatttacaaggttttaaagcaaactcaccctgatactggtatctcgcaaaag
gctatgtctatcatgaactcttttgttaacgatattttcgaaagaattgctggtgaagca
tccaagttagctgcttacaacaagaaatctactatttctgctagagaaattcaaactgct
gttagattaatcttacctggtgaattagctaagcatgctgtttctgaaggtaccagagct
gttactaaatactcttcagctgctaactaa

DBGET integrated database retrieval system