KEGG   Debaryomyces hansenii: DEHA2F18920gHelp
Entry
DEHA2F18920g      CDS       T01026                                 

Definition
DEHA2F18920p
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
dha  Debaryomyces hansenii
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dha00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    DEHA2F18920g
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    DEHA2F18920g
   00603 Glycosphingolipid biosynthesis - globo series
    DEHA2F18920g
   00604 Glycosphingolipid biosynthesis - ganglio series
    DEHA2F18920g
   00511 Other glycan degradation
    DEHA2F18920g
Enzymes [BR:dha01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     DEHA2F18920g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:1590406..1592145
Genome map
AA seq 579 aa AA seqDB search
MMTRLIILILISTYTVLAAKVNPLPIPRNITWNGDSAIKFDERMQLNISVENTIIKNAFH
RTLNTIRELKWIPAAIEVEYAQNKPTSQTVIDKANVSTVNQVDLVINDYNAPLQLGINET
YELKVDDLSPAIVIRSETIWGALHAFSTLQQLIIFDELEQSYYIEGPVYIWDTPIYQHRG
LMIDTGRNFLTVKSILEQIDVMSLSKMNSLHWHLEDSQSWPVAISSYPEMTKDAYSNNEI
YTPDEIRHIVQYSMERGVRIIPEIDIPGHARAGWRQIDNDIITCGDVSWTYNTAVEPPAG
QLDIAYNFTYTVVKKVYDEISSLFKDAVFHIGGDEVNEACYNHSKYVQEWYGRNSSLTIK
DLMQHWLDKGLPIFRNHKGRRLTMWEDIVTGNNSAINIPRDVILQCWSNGADSIKKLTNM
GYDIIVSSASHLYLDCGYGGFVTNDPRYVDSDHNEEFNQGSGGSWCNPYKTWQRIYSYDF
AANLTQEEKQHIIGVEAALWSEQVDSIVVSQKIWPRTAALAELTWSGNKDVETGKLRTNS
LTQRLLNFREYLVAIGYNASPLVPKYCMRNPHACDIQSS
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgatgacaagattgataattttaattcttatttcaacatatacggtattagctgcgaag
gtaaatcccttgccaatacctaggaatattacatggaatggtgattcagctataaagttt
gacgaaaggatgcaattgaatattagtgtggaaaataccattattaagaatgcattccat
aggacactcaacactataagggagttgaaatggataccagcagcaattgaagtggaatat
gctcagaataagccaacaagtcaaactgtcattgataaagcaaacgtatctacagtaaac
caggtagacttagtaataaacgattataatgctccgttacaattgggtataaatgaaacc
tacgagttgaaagttgacgatttgctgccagcaatagtgataagatcagagacaatatgg
ggtgcgttacacgcatttagcacattacaacagttaataatatttgatgaactagagcag
ctgtattatatagaaggaccggtgtatatatgggataccccaatttatcagcatagaggg
ttgatgattgatacagggaggaattttctaacggtgaagtctatattagaacaaattgat
gtaatgtctttaagtaaaatgaattctttgcattggcacttagaagactcccagtcctgg
cccgtggctatttcgagttatccagaaatgacgaaggatgcttattcaaataacgaaata
tatactccagatgaaataagacacatagtacaatattcaatggagcgaggtgtcagaatc
ataccagaaatagacataccgggacacgcaagagctggctggaggcagattgataatgat
attattacatgtggggacgtatcgtggacttataacactgcggtagagccaccggcggga
caactagatattgcatataatttcacatataccgttgttaaaaaagtttatgatgaaata
agctctttatttaaggatgctgtgtttcatatcggtggagatgaagttaatgaagcttgt
tacaatcactcaaaatacgtccaagaatggtacggtagaaattcatcattgacaattaag
gatttaatgcagcactggttagacaagggtttacctatatttaggaaccacaagggaaga
cggttgacaatgtgggaagatattgtaactggcaataatagtgccattaatatccccagg
gatgtgattttgcaatgctggagtaacggtgcagatagtatcaagaagctaaccaatatg
ggatatgacattattgtatcatctgcatctcatttatatttagattgtggatacggagga
tttgttactaatgatccgagatatgttgattcagaccacaatgaagaatttaatcaagga
agtggtggctcttggtgtaatccttataagacctggcagagaatttattcttacgacttt
gctgcaaatttgacccaagaagaaaagcaacatattataggagttgaggcagcactatgg
tccgagcaggttgatagtatagtcgtgagccaaaaaatatggccaaggacggctgctctt
gcagaacttacatggagtggaaacaaagatgttgaaacaggaaaattaagaacaaattca
ttaactcaacgccttcttaattttagagagtatttggttgctataggatataatgcaagt
cctctagtacccaaatactgcatgaggaacccccatgcttgtgatattcaaagtagttag

DBGET integrated database retrieval system