KEGG   Debaryomyces hansenii: DEHA2F20614gHelp
Entry
DEHA2F20614g      CDS       T01026                                 

Definition
DEHA2F20614p
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
dha  Debaryomyces hansenii
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:dha00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    DEHA2F20614g
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    DEHA2F20614g
   04113 Meiosis - yeast
    DEHA2F20614g
Protein phosphatases and associated proteins [BR:dha01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     DEHA2F20614g
Ubiquitin system [BR:dha04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     DEHA2F20614g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:1723528..1725714
Genome map
AA seq 728 aa AA seqDB search
MQIQPDQSYIEQHLRSIIIHSLDHFNYSNAEFACERLLADDPENLDSIYLYCLTLFKRER
YKSCYNKSSNLSDHLGCSFMYAKSCLKLKKHKEGIFQLLKISYLYNETSSFYQDDKFNPA
YFTTPQSRYNYENSRSILPDSSTIYRLLGDLYKGMGDTKNSALNYGEALKYNQFDYEAFQ
ELCKLGVNVKVKAIYKSNSVFNSDYQSQIKEKDSLKILNDMSGNNITNPFSATTSANETN
TNNTIANPNNINGNKSNSNLLADDSFSNPISTPRVTVPSVPDAPLRKAGNNEPLTNRFEF
TKPSFPIDTTSSLSIDPNARQTKRESTYSKITSRLISQPNNNKPTDNNAPANINTNNLNK
RTAVRGSLKRNSPNSFSANTHTNNENHQAPLSIMANKEIELGDNYLLGLYMVFSKGFKSM
CKYDCYKAIRILESLPQKEKESPWVLSKLGRLHYEIVNYKQSEYFFVKLRKLDRTRLEDM
EYYSTLLWHLHKKVELTYLANELHDLDPHSPITWCTIGNLFSLTREPDEAIKCFNKSIKF
DESFIYAYTLKGHEYFGNDNYEMALENFRISLLIDSRHYNALYGIGMVYINLGDYQKADY
HFRKAVSINPINVILICCVGMVLEKVGKNNLALRQYELANKLQPLNPLPIFKKAQLLFSM
QQFQQALHYFKVLKDLAPDEASVHFLLGQLYNIQNDKFQAIKEFTIALNLDPKGNYLIRE
AMESLKDK
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatacaaccggatcaatcctacattgaacagcatctaaggtcgatcataattcat
tcattagatcacttcaactattcaaatgcagagtttgcctgtgaaagattgttagctgat
gatcctgaaaatctagattctatatacctttattgtctaacattgtttaagagagaaagg
tataaatcatgctataacaaatccagcaatttatcggaccatttgggttgcagctttatg
tatgcgaaactgtgtttgaaattgaaaaagcacaaggaagggatttttcagttgcttaag
ataagctatctttataatgaaacatcttcattctatcaggatgataaattcaatccagcg
tattttacgacgccccaatcgagatacaactatgaaaattctcgatcaattcttcctgat
ctgtctaccatttatcgcctattaggggatttgtataagggaatgggtgatactaagaat
agtgctcttaattatggagaagctttaaaatataatcagtttgactatgaagcattccag
gagttatgtaagttaggcgtcaatgtcaaggtcaaagcaatctataagtcaaacctggtt
ttcaatagtgattatcaatcacaaattaaagaaaaagatagtcttaaaatactaaatgat
atgagtgggaataatataaccaatccgttctctgctaccactctggctaatgagactaat
accaataatacgattgcaaatcctaataatataaatggtaataaatcaaattcaaattta
ctagcagacgatagtttcagtaatccgatatctaccccaagagtgacagtaccgagtgtt
cccgatgcacctttaagaaaagctggaaacaatgaacccctaactaatcgatttgaattc
accaaaccaagctttccaatagacacaaccagttcattaagcatagatcccaatgcaaga
caaactaaacgggaaagcacctactctaagataacttccagattgatttcccaacctaat
aacaataaacctacagataataacgcaccagctaacataaatactaataatcttaacaag
cgaacagctgtgcgtggtagcttgaaaagaaacagtcctaatagtttttctgccaacact
cacaccaataatgagaatcaccaagcaccattgagtattatggctaataaagaaattgaa
ttaggcgataattatttgttaggactttacatggtattttctaagggtttcaaaagtatg
tgtaaatatgactgttacaaagctatcaggatccttgagtcattgcctcagaaggagaag
gaaagtccctgggtgttgagtaagttgggaagattgcattatgaaattgtaaattataaa
caatcggagtatttctttgttaaactaaggaaattagatagaacaagacttgaagatatg
gaatactactctacgttattgtggcatttgcataaaaaggttgaattgacttatctcgca
aatgaattacatgatttagatcctcattctccaataacttggtgtacaattggtaatttg
ttttccttgactagagaacccgacgaagctataaaatgttttaacaagtctattaaattc
gatgaaagcttcatttatgcttacacattgaagggccacgaatattttggtaacgataac
tacgagatggccttagagaatttccgtatcagtttactaatcgactcgagacactacaat
gcattatacggtattggaatggtttatatcaaccttggtgactaccagaaagcagactat
catttccgcaaagctgtctcaatcaatcctatcaatgtaatcttgatatgttgcgtcgga
atggttcttgagaaagtaggtaagaataatttggccttaagacaatatgaattggcaaat
aaacttcagccattaaatccattaccaatattcaaaaaggcgcaattattattctcgatg
caacagttccaacaggctcttcattatttcaaggttttaaaagatttggctcctgatgaa
gcttctgtccatttcttgttgggacaattgtacaatattcaaaacgataaatttcaggcc
ataaaagagtttaccattgcattaaatttggatccaaaaggaaattatttaattcgcgag
gcaatggaatccttgaaggataaatag

DBGET integrated database retrieval system