KEGG   Debaryomyces hansenii: DEHA2F20614gHelp
Entry
DEHA2F20614g      CDS       T01026                                 

Definition
DEHA2F20614p
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
dha  Debaryomyces hansenii
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:dha04120]
Cellular Processes; Cell growth and death; Cell cycle - yeast [PATH:dha04111]
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:dha04113]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:1723528..1725714
Genome map
AA seq 728 aa AA seqDB search
MQIQPDQSYIEQHLRSIIIHSLDHFNYSNAEFACERLLADDPENLDSIYLYCLTLFKRER
YKSCYNKSSNLSDHLGCSFMYAKSCLKLKKHKEGIFQLLKISYLYNETSSFYQDDKFNPA
YFTTPQSRYNYENSRSILPDSSTIYRLLGDLYKGMGDTKNSALNYGEALKYNQFDYEAFQ
ELCKLGVNVKVKAIYKSNSVFNSDYQSQIKEKDSLKILNDMSGNNITNPFSATTSANETN
TNNTIANPNNINGNKSNSNLLADDSFSNPISTPRVTVPSVPDAPLRKAGNNEPLTNRFEF
TKPSFPIDTTSSLSIDPNARQTKRESTYSKITSRLISQPNNNKPTDNNAPANINTNNLNK
RTAVRGSLKRNSPNSFSANTHTNNENHQAPLSIMANKEIELGDNYLLGLYMVFSKGFKSM
CKYDCYKAIRILESLPQKEKESPWVLSKLGRLHYEIVNYKQSEYFFVKLRKLDRTRLEDM
EYYSTLLWHLHKKVELTYLANELHDLDPHSPITWCTIGNLFSLTREPDEAIKCFNKSIKF
DESFIYAYTLKGHEYFGNDNYEMALENFRISLLIDSRHYNALYGIGMVYINLGDYQKADY
HFRKAVSINPINVILICCVGMVLEKVGKNNLALRQYELANKLQPLNPLPIFKKAQLLFSM
QQFQQALHYFKVLKDLAPDEASVHFLLGQLYNIQNDKFQAIKEFTIALNLDPKGNYLIRE
AMESLKDK
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatacaaccggatcaatcctacattgaacagcatctaaggtcgatcataattcat
tcattagatcacttcaactattcaaatgcagagtttgcctgtgaaagattgttagctgat
gatcctgaaaatctagattctatatacctttattgtctaacattgtttaagagagaaagg
tataaatcatgctataacaaatccagcaatttatcggaccatttgggttgcagctttatg
tatgcgaaactgtgtttgaaattgaaaaagcacaaggaagggatttttcagttgcttaag
ataagctatctttataatgaaacatcttcattctatcaggatgataaattcaatccagcg
tattttacgacgccccaatcgagatacaactatgaaaattctcgatcaattcttcctgat
ctgtctaccatttatcgcctattaggggatttgtataagggaatgggtgatactaagaat
agtgctcttaattatggagaagctttaaaatataatcagtttgactatgaagcattccag
gagttatgtaagttaggcgtcaatgtcaaggtcaaagcaatctataagtcaaacctggtt
ttcaatagtgattatcaatcacaaattaaagaaaaagatagtcttaaaatactaaatgat
atgagtgggaataatataaccaatccgttctctgctaccactctggctaatgagactaat
accaataatacgattgcaaatcctaataatataaatggtaataaatcaaattcaaattta
ctagcagacgatagtttcagtaatccgatatctaccccaagagtgacagtaccgagtgtt
cccgatgcacctttaagaaaagctggaaacaatgaacccctaactaatcgatttgaattc
accaaaccaagctttccaatagacacaaccagttcattaagcatagatcccaatgcaaga
caaactaaacgggaaagcacctactctaagataacttccagattgatttcccaacctaat
aacaataaacctacagataataacgcaccagctaacataaatactaataatcttaacaag
cgaacagctgtgcgtggtagcttgaaaagaaacagtcctaatagtttttctgccaacact
cacaccaataatgagaatcaccaagcaccattgagtattatggctaataaagaaattgaa
ttaggcgataattatttgttaggactttacatggtattttctaagggtttcaaaagtatg
tgtaaatatgactgttacaaagctatcaggatccttgagtcattgcctcagaaggagaag
gaaagtccctgggtgttgagtaagttgggaagattgcattatgaaattgtaaattataaa
caatcggagtatttctttgttaaactaaggaaattagatagaacaagacttgaagatatg
gaatactactctacgttattgtggcatttgcataaaaaggttgaattgacttatctcgca
aatgaattacatgatttagatcctcattctccaataacttggtgtacaattggtaatttg
ttttccttgactagagaacccgacgaagctataaaatgttttaacaagtctattaaattc
gatgaaagcttcatttatgcttacacattgaagggccacgaatattttggtaacgataac
tacgagatggccttagagaatttccgtatcagtttactaatcgactcgagacactacaat
gcattatacggtattggaatggtttatatcaaccttggtgactaccagaaagcagactat
catttccgcaaagctgtctcaatcaatcctatcaatgtaatcttgatatgttgcgtcgga
atggttcttgagaaagtaggtaagaataatttggccttaagacaatatgaattggcaaat
aaacttcagccattaaatccattaccaatattcaaaaaggcgcaattattattctcgatg
caacagttccaacaggctcttcattatttcaaggttttaaaagatttggctcctgatgaa
gcttctgtccatttcttgttgggacaattgtacaatattcaaaacgataaatttcaggcc
ataaaagagtttaccattgcattaaatttggatccaaaaggaaattatttaattcgcgag
gcaatggaatccttgaaggataaatag

DBGET integrated database retrieval system