KEGG   Debaryomyces hansenii: DEHA2F20834gHelp
Entry
DEHA2F20834g      CDS       T01026                                 

Definition
DEHA2F20834p
Orthology
K11422  
histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
dha  Debaryomyces hansenii
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:dha00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    DEHA2F20834g
Enzymes [BR:dha01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     DEHA2F20834g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:1740539..1743805
Genome map
AA seq 1088 aa AA seqDB search
MSYNPYRSRNYGGGYSNNGYRQRHYYSDYNESSYNSSYRDQYDRNGSYSGSKGRHYNSGT
SRNAPPPSSSAYSSDSSSRTYANSSSSGPAKIPVGPKSLTIDGSTNGDLPTAGTQKHNIP
PTNAISGTDATTGVNPNDSNFTQLLLHQDLSKQIEFSGEIDSKRNYKVIYDPELDKSLSK
AERKTKQKKIRFNGESLSSHDVTDPRKSSTGSTSAYFLKPNKKSKKFPFKQLPQPKFIYD
KDSLGPPPQNEIVVWDLPSTTSEVYLSNFFKSYGDSIKDLKFINDPLNAVPLGIATCKFQ
GNPDKSMRIAKKFIANVRINHTKIDGAELKIALNDNDNKLLDDKIKVAQDKLRISRIKIE
EEEKKRLKKQQAIEDQKRRETEKAAKEKKLQESANSSHESRFKPNTTTLSIRHHNEVIPG
VFLPRELRKYIRDRPYIFINDKYVPTRKVSSQDIKKVLNKYDWTRVLPDRSGFFVVFNSI
KECERCFINEDGRKFFEYKMFMELALPENFNESSSSTSNNDNTDLSASNRKQNDVVEEAS
NMLIKEFQNFLAKDIRERVIAPVVLDLLSHDKYPKLVEELKAKELATKKAASPIVTNAVR
QVKSKPNVLSSLAIKSKPQAILPSFRKKKDLPNAGLNSANKAKKNVIPMQHALNYDHESD
ESDEDDSTRSTTPLTPTLKRERSPTVSSVSNDNDIEDKLEDIQKPSKKKQKKTKLHQSFL
YDSASDEDMEAVSEEKEVEKDESEGEEDIDYSHIDKIYQPTEDYPRPVYEEVPRFPSDPL
DLDALQSIIKDDEDITLLQTALADVTSESNIKNMEYWAWKQKDIKAKAGVQEISEDLEVI
GPLDSRFDSKSGAFKSEGYRKIPDADKIEYLPHRRKIHKPIKTIQHDDDELNANNSTTNN
NSNNIQSSRVNRANNRRFAADISAQKQMLGSETDILNLNALTKRKKPVSFARSAIHNWGL
YALEPIAAKEMIIEYVGESIRQQVAEHRERSYLKTGIGSSYLFRIDENTVVDATKKGGIA
RFINHCCNPSCTAKIIKVEGKKRIVIYALRDIEANEELTYDYKFEKETNDAERIRCLCGA
PGCKGYLN
NT seq 3267 nt NT seq  +upstreamnt  +downstreamnt
atgtcatataatccttatcgactgaggaattacgggggaggatattcaaataacggttat
cgacaacgacattattatagtgattataatgagagttcctataattcttcataccgtgat
caatatgacagaaatgggagttattccgggagtaaagggcgtcattacaattcaggtacg
agtcgaaacgctccaccgccaagttcatcagcatattcgtcggattcgtcgtcacgtact
tacgcaaactcgtctagttcaggtccagcaaagattccagtggggcccaaatcattgacc
atagatggttctacaaatggagacttgccaacagcaggaactcagaagcataatatacca
cctacgaacgcaataagcggtacggacgctactacgggtgtgaatccaaatgattccaat
tttacgcagcttttacttcaccaggatctactgaaacaaattgaattttcaggcgaaata
gactcaaagagaaactacaaagtgatatacgacccggagttagataaatcactttccaaa
gcagaacgcaagaccaaacagaaaaaaattaggtttaatggggaatcactttctagccat
gatgtcactgatccaagaaaatcaagtactggaagcacgtcagcatacttccttaagcca
aataaaaaatcaaagaaattccctttcaagcaattgccacaaccaaagttcatttacgat
aaagattctttaggacccccgccgcagaatgaaatcgttgtgtgggacttaccatcaaca
acaagcgaggtttatttgagtaattttttcaagagttatggtgattcaattaaagatttg
aaatttattaatgatcctttgaatgctgttccattaggtattgctacatgcaaatttcaa
ggaaacccagataagtctatgcgtattgcgaagaagtttattgctaacgtcagaataaac
cataccaaaatagatggtgctgaattaaaaattgcccttaatgataacgataataagtta
ttggatgataaaataaaggtagcacaagataaattgcgaatttcaagaattaaaatcgaa
gaagaagaaaagaagcggcttaaaaagcaacaggcaattgaagatcaaaagagacgggaa
acagaaaaggcagcgaaagaaaagaaattgcaagagtctgcaaattcttcacatgaatca
agattcaaacctaatacaacaacattatcaataaggcatcataacgaagttattccgggc
gtatttttgcctagagagttaagaaaatacattagggatcgtccttatatttttataaat
gataagtatgtgcctactagaaaagtttcatcccaagatattaaaaaggttctcaacaag
tacgattggacgagagtccttccggatagatctgggtttttcgttgtattcaactcaata
aaagaatgtgaaaggtgcttcataaatgaagacggaagaaaattttttgaatataagatg
tttatggaattagcattacccgaaaatttcaacgaaagctcctcactgacttctaataat
gataacactgatttatctgcatccaataggaaacagaatgatgttgtggaagaagcaagt
aatatgttgatcaaggaatttcagaacttcttagctaaagatatcagggaaagagtcatt
gctcctgttgttcttgatttattgagccatgataaatacccaaaattggtggaagaactc
aaggctaaggaattggccacaaagaaagcagcatcacctatagttactaacgctgtacgt
caagttaaactgaaacctaatgtgttgtcttctcttgctattaagagcaagccccaggca
atattaccaagctttagaaagaagaaggatttgccaaatgctggattgaattcagctaat
aaagcgaaaaagaatgtaattccaatgcaacatgcacttaattatgatcacgaatcagat
gaatcagacgaagatgactcgactagatcaactactcctttaactccaacattgaaaaga
gagcgaagtccgaccgttagcagtgtgagtaatgataacgatattgaagataaattggaa
gatattcaaaaacctctgaaaaagaaacagaagaaaacgaaattgcatcaatcattcttg
tatgattcagcgtctgatgaagatatggaagctgtttcagaagaaaaagaggtagaaaag
gatgaaagtgaaggtgaagaagacatagattattctcatatagataaaatttatcaaccc
acagaagattatccacggccggtatatgaagaagtcccaaggtttcctagtgacccgctt
gatttggatgccttacaaagtatcatcaaagatgatgaagacatcacactacttcaaacg
gcattggctgatgtaacatctgaatcgaatataaagaacatggaatactgggcttggaag
cagaaggatattaaggctaaggcaggcgtccaagagatttctgaagatttagaagtcata
ggtccattggattctcgattcgactcgaagagcggtgctttcaagagtgaaggatatagg
aagattcctgatgctgataaaattgaatatctcccccatcgtcgtaagattcataagcca
attaaaactattcaacatgatgatgatgaattgaatgctaataattctacaacaaacaac
aatagtaataatattcaaagttctcgtgtcaatagagctaataacagaaggtttgcagct
gatatcagtgcgcagaagcaaatgcttggaagtgaaacagatattttaaacttaaatgcg
cttaccaaacgtaagaagccggtttcatttgccagatctgctattcataactggggattg
tatgctttagaaccaattgcagctaaggaaatgatcattgagtatgttggtgagagtatc
cgtcaacaagttgcagagcatagggaaagaagttatttaaagacaggaataggttcgtca
tatctctttaggatcgatgaaaatacagtggtagatgccacaaaaaaaggtggtatagct
agatttatcaatcactgttgtaatccaagttgtactgctaaaatcattaaagtcgaaggt
aagaagagaattgttatttatgcattacgtgatattgaagctaacgaagagttgacttat
gattataagtttgaaaaggagaccaacgatgctgagcgtattagatgtctatgtggtgct
cctggttgtaaaggctacttaaactaa

DBGET integrated database retrieval system