KEGG   Debaryomyces hansenii: DEHA2F23452gHelp
Entry
DEHA2F23452g      CDS       T01026                                 

Definition
DEHA2F23452p
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
dha  Debaryomyces hansenii
Brite
Protein kinases [BR:dha01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   DEHA2F23452g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:complement(1947083..1954636)
Genome map
AA seq 2517 aa AA seqDB search
MSTTQLQIVDGIALTQIFNGLKSNKEEERNRYALELRNYLASIARDLSPEQFNRYNNDIN
KTIFEFLHSNETSEKLGGIAALNSLIDFDSGVGEENATKTARFSNYLGSLILSNDLTIMK
QATMTLGKLATPGGTLTGDFVDFEAKRAIEWLQSDNKQHENRRHAAILIITALVDNAPTL
LYNFINQILEHLWIPLRDSKLVIRTDAAIALQKCMRIIYDRDINSRRFWIKHFIDMASKI
LNENVARNPTSESNDSSNNGSGNNSVNSVNAAASTAYNLIYSTATGSQTNESIHGSLLVY
RELITFHSDPYIHSKFELIYENTVLYRNHKQAIIRQELTKIIPLLCKVNTELFVEKYLHR
TLLHYLSQLKQLKSQHSETANNDKSAIFRSIGLISLEVGNQMATYLDAILDNIRDGLSYP
SNPSVQSILVNAVSNNGDNPLSGAVTSSNGSSQSTINGLNSISTSGSGPTKYRLSRKNTE
PAIFDCISKLSIAVGPALTKHLQRDILDMMFSNCSLSVYMQNVLQTLIVNIPMLTNLISM
KLLNLLSLVLSGKIFQPPGSPYGSIKMNESLARDYRLIMISRDTGLSINSILNDADDYEN
YDSAILVQALNMLAFFEFENYQLNEFVRYCTITYLEHNVPKVRQTATITSCEIFIKDPIC
QQTSVNALNAVNEVLDKLLSIAITDPIPEIRLEGLNCLANAGNFDPQLSQANNVRLLFIA
LNDEVFSIRKIAIKILGRLSSINPAYIVPSLRKTLIQLLSRLEYSPTSRKKEESATLISL
LISNSKELTRPYVKPIVEALLPKAKDPSSSVAASAINCLGELAVVGGEDLQPFIPDLMPL
ILETFQDQSSSYKRDAALKTLGQLASSSGYVIKPLLDYPQLLGMLVGILKSESSPHIRRE
TVRLLGILGALDPYKHREVEQNSKNIPSEQNAPPVDVALLMQGMSPSNDEYYPTVAINNL
MKILKDPSLTAHHNKVIQAIMYIFQTLGLRCVSFLPQIIPGIINVMNTCQPSMLKFYFQQ
LGALILIVKQHIRPFLPEIFEVIKESFNINIQLNVQVIIINLIESISRALEGEFKMHLPD
VLNLMLNVFEDDKSVKREPSLHVLKAFVVFGSSIEEYVHIIVPNIVKMFEMGPIVLRRAA
IETIGRLSKQVLLNDMASRIIHPILRVLRQGNDELKTTAMNTLSYLLLQLGNEFSVFIPV
IKSLLIQQKIHSAIFEQLVNKLLSGDPLPAYLNIYKDYDIHVNHFDVPDVDMPSKKLPVN
QGALKAAWDSSSRQTKEDWQEWIGRLSKELLKQSPSHAIRACAGLATDYHPLAKDLFNAS
FASCWSELYSQHQEELVESFCIALSSANNPPEIHQILLNLAEFMEHDDKSLPIAITTLGQ
YAQRCHAYAKALHYQELEFYVEPTTPTIESLISINIQLQQSDAAVGILKHAQLHHDLQLK
ETWYEKLQRWDDALRAYSLREKQEPDNMEITMGKMRCYHALGEWEQLSELAQSKWNNSSS
DIKRGVAPLAAAAAWGLGQWDRMDACIKVMKTESPDKAFFNAILSLHRNSFEDASNHILK
ARDLLVTEITALVSESYNRAYGVVVRVQMLAELEEIIKYKCLPQGSEKRVIMRKTWNTRL
LGCQRNVDIWQRMLKVRALVIKPKQDMDMWIKFANLCRKSGRLNLAEKSLNYLLEEGSPE
NPSRAPPQVVYAQLKYMWAKGQQREALRHLVDFTTRMSQDLGLNPNDLITQPLPSEGPGI
PKHVEEYTKLLARCFLKQGEWQILLNNNWRTETSEIILGAYLLATHFDDKWYKAWHNWAL
ANFEVISLFTSQNNNGNNGTINVSQGEIMDQNDQVVTSSDEQSQQPQRQIQPANIIPMDV
VQRHVVPSIKGFFHAIALSNTNSLQNTLRLLTLWFKFGGIPEAAQAMNEGFNMVKIDNWL
EVVPQLISRIHQPNQTVSRSLIGLLSDLGKAHPQALVYPLAVAVTSESVSRKRAALSIID
KMRLHWATLVDQSDLVSHELIRVAVLWHEQWYEGLEDASRLFFGEKNTEKMFEVLEPLHQ
MLQKGPETMREASFNNAFGRELADAYEWVLNFRRTKDITNLNQAWDIYYNVFRRISRQLP
QLSSLELQYVSPKLEEANNLELAAPGTYHAGKPTIKIVKFDPTFSVISSKQRPRKLSCKG
SDGKEYQYVLKGHEDIRQDNLVMQLFGLVNTLLVNDPECFKRHLDIQQYPAIPLSPKVGL
LGWVPNSDTFHVLIREYRESRKILLNIEHRIMLQMAPDYDSLTLLQKVEVFTGALDNTRG
QDLYKVLWLKSKSSEAWLDRRTTYTRSLAVMSMVGYILGLGDRHPSNLMLNRITGKVIHI
DFGDCFEAAILREKYPEKVPFRLTRMLNYAMEVSGIEGSFRITCEHVMRVLRDNKESLMA
ILEAFAYDPLINWGFDFPTKAVAEATGINVPQVNIAELLRREQIDEQEAARLTRQNEIEI
RNARAALVLKRITDKLTGNDIKRLNDLDVPTQVDKLIQQATSVESLCQHYIGWCSFW
NT seq 7554 nt NT seq  +upstreamnt  +downstreamnt
atgtctacaactcagctacaaatagttgacggtatagcattaacccaaattttcaatggt
ttaaaatcaaataaggaagaagagagaaatagatatgccttagaattacgaaattatcta
gcgtctatagctagagatctatctccggagcagttcaatcggtataataatgatatcaac
aaaactatttttgaatttttgcatagtaatgaaacctcggagaagttggggggtatagca
gcgttgaattcattgattgattttgattcgggtgtaggagaagaaaatgctacaaagacg
gctagattttcaaactacttgggttcattaatcttgtcaaacgatttaacaatcatgaag
caagcaaccatgactttaggtaagttggcgacacccggtggtactcttacaggtgacttc
gttgattttgaagcaaaaagggccatagaatggttacagagtgacaataaacaacacgag
aacagaaggcacgcagcaatattgattatcactgcattggtggataatgctcctacgtta
ttgtataattttataaaccagattttggagcatttatggattccattgagagatagcaaa
ttggtgataagaactgatgcagctattgctttacagaaatgtatgcgaataatttatgat
agagatattaactctcgtcgattttggatcaaacatttcatagatatggcttcaaagata
ttaaacgaaaatgttgctagaaaccccacatctgaatccaacgactcaagcaataatgga
agcggcaataatagtgtgaactctgttaacgcagcggcaagtacggcctataatttaatt
tattccacagctacgggatcacaaactaacgagtcaatccacggttctcttcttgtgtac
agggaactaattacatttcatagtgatccatacattcattccaagtttgaattgatttac
gaaaatacagtattgtataggaatcacaagcaagctataattaggcaagaattaactaag
atcattccactactatgcaaagtaaatacagaattatttgttgaaaaatatttgcacaga
acattgttgcattatttgtcacagttaaaacaattaaaaagtcaacacagtgagactgcc
aataatgataaaagtgccatttttagaagtatagggttaatttcgttggaagtagggaac
caaatggctacttatttggatgctatattagataatattcgagatgggttatcttatcct
tctaatccaagcgtgcaactgattttagtaaatgcagtatctaataatggagataatcca
ctatctggtgcagtgacgtcgagtaatggatcctcgcaatcgacaatcaatggtttgaat
agcatttctacttcaggttccgggcccacaaagtatagattgagtcgaaagaatactgaa
cctgccatttttgattgcatcagtaaattgtcgattgccgtaggtccagctttgacaaag
catttacaacgtgatatattagatatgatgtttagtaattgttccttatcggtctacatg
cagaatgttttacaaactttgatcgttaatattccgatgttaactaatcttataagcatg
aagttattaaacttattaagtttggttttatcaggtaagattttccaacctcctggttcg
ccttacggatccatcaaaatgaacgaatcattagcaagagactatagattaataatgata
tcaagagacacaggattgagtatcaacagtatacttaatgacgcggatgactatgaaaat
tatgatagtgcaatcttggtccaagcattaaatatgctagcattttttgagttcgaaaac
taccagctaaacgagtttgttagatactgcacaattacgtatcttgaacacaacgttcct
aaagttcgtcaaacagccacgataacatcctgtgaaatatttatcaaggatccaatttgt
caacaaaccagcgtgaatgcattaaacgctgttaatgaggttttagacaagcttctatca
atagccatcaccgatcctataccagaaatacggttagaaggtttaaattgtttggcaaat
gctggaaattttgatcctcaactttcccaagctaataatgttagacttctatttattgca
ttaaacgatgaagtattcagtattaggaagatagcgataaaaatattgggtagattatca
tcgataaatcctgcctatattgttccttctttaaggaaaactttaatacaattgttatcg
cgtttggaatactcaccaacaagccgtaaaaaggaagaaagtgctacattgatatcgctt
ctcataagcaattcaaaagaattaaccagaccttacgtgaagccaatagttgaagcatta
ttgcctaaggctaaagatcccagttcatcagtggcagcaagtgcaatcaattgtcttggt
gagctagcagttgtaggtggggaagatttgcaaccttttattcctgatttgatgccacta
attttggaaacgtttcaagatcagagttcttcttataagagagatgctgctttgaagacg
ttgggccaattggcaagttcgtctggctacgttattaagcctttacttgactatccgcag
ttattggggatgttagtaggaatattgaaactggagagttcgcctcacataagaagggaa
acagtaaggctattgggtatattaggtgctttggacccttataagcatcgtgaagttgaa
caaaattctaagaatataccttcagaacaaaatgcaccaccagtggatgttgcattgtta
atgcaaggtatgtcaccttctaatgatgaatactatccgacagttgccataaataaccta
atgaaaattttaaaagacccatcattgacagctcatcataataaagtaattcaagccatt
atgtacattttccaaacattgggattaagatgtgtttcatttttaccacagatcattcct
ggaattattaatgtcatgaatacatgtcagccttcgatgttgaaattttacttccagcaa
ctaggtgcattaatattgatagttaaacaacacataagaccattccttcctgaaatattt
gaagtcatcaaagagtcgtttaacataaacatccaattaaatgttcaggtgatcattata
aatttgatagaatccatttcaagggctttagaaggggaatttaaaatgcatcttccagat
gttttgaatttgatgttaaatgtttttgaagatgataaatcagttaaaagagaaccatcg
ttacatgttttgaaagcatttgttgtttttggaagtagcattgaagaatatgtccatata
attgtcccaaacatcgtgaaaatgtttgaaatggggccgattgtattacgtagggctgca
attgagacaattggaagattatcgaagcaagttctattaaatgatatggcatctagaatc
atacatcccattttacgtgtattgcgccaaggcaatgatgaattgaaaactacggcgatg
aatactttaagttacttactattgcagttgggtaatgagttcagtgtgttcattcctgta
atcaaatcattgttgatacagcagaaaattcattcagcaattttcgagcaacttgttaat
aagttattaagtggagatccattaccagcttatcttaacatttataaggattatgatatc
catgttaaccattttgatgttcctgacgttgatatgccatcgaaaaagttaccggtaaac
caaggtgcattaaaggcagcttgggattcaagtctgcgtcaaaccaaagaagactggcaa
gaatggattgggaggttaagtaaagaattattgaagcaaagtccatcgcatgcaataaga
gcatgcgctgggttagcaactgattatcatcctttggcaaaggacttgtttaacgcaagt
tttgcaagttgctggagtgaattatattcccagcaccaagaagagttagtagaatcattt
tgtattgcattatcatcagcaaacaatcccccagaaatacatcagattttattaaattta
gctgaatttatggaacatgacgataaatctttaccaatagcaataacaactttaggtcag
tatgcgcaacggtgccatgcatatgctaaagcattgcattatcaagaattagaattttat
gtggaacctacgacaccaaccattgaatctttaattagtatcaacattcagcttcaacaa
tctgatgcggctgttggaattttgaaacatgcacagttacatcatgatctccaattaaaa
gagacatggtatgagaagttacaaagatgggatgatgccttgcgagcttatagtttaaga
gagaaacaggaaccggacaatatggagattaccatgggtaaaatgagatgttaccatgct
ttaggagaatgggagcagttatcagaattagcccaaagtaaatggaataactcttcaagt
gacataaagagaggagtggctcctttagcagcagcagcagcttgggggttaggccaatgg
gatagaatggatgcatgtattaaggttatgaaaactgaatccccagataaagctttcttt
aatgcaattttaagtttacatcgtaatagttttgaggatgcatctaatcacatattgaaa
gcaagagacctattagtaactgaaatcacagcattggtgagtgaaagttataatagagct
tatggtgtcgtagtaagggtacaaatgcttgcggaattagaggaaattattaagtataaa
tgcttaccacaagggtcagagaaacgtgttataatgagaaaaacctggaataccagatta
cttggatgtcagaggaatgttgacatttggcaaagaatgttgaaagttagagctcttgtt
attaaacctaaacaagatatggatatgtggattaaatttgcaaatttatgtcgtaaatca
ggaagattgaatttggctgaaaagtccttaaactatttgttggaagaaggttcaccagaa
aatccatctagagctccaccacaagttgtgtatgcacaattgaaatatatgtgggctaag
ggccaacaaagagaagcattacgccatttagttgattttacaactcgaatgtctcaagat
ttgggtttaaacccaaatgacttaattactcaaccattaccgtctgaaggtccaggtatt
ccaaagcatgtggaagagtataccaaattattggctagatgttttttgaagcaaggtgaa
tggcaaatattattgaacaataattggaggactgaaacatcagaaattattttgggggca
tatcttttggctacacattttgatgacaaatggtataaagcatggcataattgggctctt
gctaattttgaagttatttcactttttacttcgcagaataacaacggcaacaatggtaca
atcaatgttagtcaaggtgaaataatggatcaaaatgatcaagttgttacatcatctgat
gaacaatctcaacagccacagagacagatacaacctgcaaatattataccgatggatgtt
gttcagcgacatgttgttccatcaataaaaggattctttcacgctatcgcattgtcaaat
acaaattctttgcagaatacgttgagattacttacattgtggtttaagtttgggggaata
ccagaggcagctcaagctatgaatgagggatttaatatggttaagattgataactggttg
gaagttgtacctcaattaatctcacgtattcatcaaccaaatcaaacagtcagtagatct
ttaattggattattgagtgatttgggtaaagcgcatcctcaggcactcgtgtatccgtta
gctgtcgcagttacgtctgaatcggttagccgtaaaagggcggcattgtcaattattgat
aaaatgcgtttgcattgggctacgttggtagatcaatctgatttagttagtcatgaattg
atcagagttgcagtcctctggcacgagcagtggtacgaaggtctagaggatgcatcaaga
cttttctttggtgaaaagaacactgaaaagatgtttgaggtgttagaacctttgcatcaa
atgctacaaaaaggccccgagactatgagagaagcatcatttaataatgcatttggtaga
gaacttgctgatgcctatgaatgggttttgaacttccgtcgtacaaaagacattactaat
ctaaatcaagcgtgggacatttattataatgttttccgcagaattagtagacaattgcct
caattgctgagtttggaattacagtatgtatcgccaaagctagaggaagcaaataatctt
gaattggctgctccaggtacataccatgctggaaagccaacaatcaagattgttaagttt
gatccaacgttctcagttatctcatcgaaacagagaccaagaaaattatcttgtaaaggt
agtgatggtaaagaataccagtacgttttgaaaggacacgaagacattagacaagataat
ttggttatgcaattatttggtttagttaacacattattggtaaatgatccagaatgtttc
aaaagacatttagacattcaacaatatccagcaattccgttatcacctaaagttggttta
ttaggttgggtaccaaacagtgatactttccatgtcttgattagggaataccgtgagtcg
cgtaagattttattaaatattgaacatcgtattatgttgcagatggctcctgattatgac
agtcttacattactacaaaaagtggaagtattcacaggggctttagacaacaccagaggc
caggatttgtataaggtattatggctcaaatcaaagtcttcggaagcgtggttagatcgt
cgtacaacgtatactcgttcattggcagtaatgtctatggtaggctacattttaggttta
ggtgaccgtcatccttctaatttgatgcttaataggattacaggtaaggttattcatatt
gattttggtgattgttttgaggctgctattttacgtgaaaagtatcccgaaaaggttcca
tttagattaacaagaatgcttaattatgctatggaagttagtggtattgaaggttcattc
cgcataacatgtgaacatgttatgagagtcttaagggacaataaggagtcattaatggca
attttggaagcattcgcatatgatccattgattaattggggatttgacttcccgacaaaa
gcagtggcggaagctactgggattaatgtaccgcaagttaatatagcagaattattgaga
agagaacaaatagatgaacaagaagcagctagattaacgagacaaaacgaaatcgagatt
agaaacgcgagagctgcattggtgttgaagagaattactgataagttaactggtaatgat
attaaaagattgaatgatttagatgtaccaactcaagtggataaattaattcagcaagct
acaagtgtagagagtttatgtcagcattatattgggtggtgttcattttggtag

  All links  
No link information was found.   
DBGET integrated database retrieval system