KEGG   Debaryomyces hansenii: DEHA2F23782gHelp
Entry
DEHA2F23782g      CDS       T01026                                 

Definition
DEHA2F23782p
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
dha  Debaryomyces hansenii
Pathway
Meiosis - yeast
Module
cAMP signaling
Brite
KEGG Orthology (KO) [BR:dha00001]
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    DEHA2F23782g
Enzymes [BR:dha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     DEHA2F23782g
Protein kinases [BR:dha01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   DEHA2F23782g
Messenger RNA biogenesis [BR:dha03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     DEHA2F23782g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:complement(1974476..1975738)
Genome map
AA seq 420 aa AA seqDB search
MPSSNLLRKLHIGKSNNNAKNNTTSEITVNSLGNIESMDQYNQYQSPQSQPQQLNPLPGQ
AQGFSSDQTQNLATGQQLTAEQQRVDDAIKRSLLPERSTVSKGKYSLADFRILRTLGTGS
FGRVHLVRSAHNGRYYAIKVLKKQQVVKMKQVEHTNDERRMLKLVEHPFLIRMWGTFQDS
RNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVTLAVEYLHSHDIIYRDLKPENIL
LDRNGHIKITDFGFAKEVSTVTWTLCGTPDYIAPEVITTKPYNKSVDWWSLGVLIFEMLA
GYTPFYDSTPMKTYEKILSGKIHFPSFMGPDVIDLLSKLITADLTRRLGNLMNGPSDIRN
HPWFSEVVWEKLLAKDIETPYEPPITAGVGDSSLFDHYPEEKLDYGTVGEDPYAQYFLEF
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgccatcttctaacttattgagaaagcttcatatcggtaaaagtaacaacaacgctaaa
aacaatacaacatcggaaataacagtaaattcgctaggtaatattgaatcaatggatcaa
tacaatcaataccaatctccacaatcgcaaccgcagcaacttaatccattgccaggtcag
gcgcaaggattcagcctggatcagacacaaaatttggctactggacagcaattgactgcc
gaacaacaacgtgttgatgatgctatcaaacgttctttgttacccgaacggtcgactgtt
tctaagggcaaatattctttagctgactttagaatattgagaactttagggactggttcg
tttggtagagttcatttggtacgctcagcccacaatggtcgttactatgcaataaaggtg
ttgaagaagcaacaggtggtaaaaatgaaacaagtcgaacacacaaacgacgaacggaga
atgttaaagttggtcgaacacccatttttaattaggatgtggggtactttccaagattcg
aggaatttgttcatggtaatggattatattgaaggtggtgaattattcagcttgttaaga
aaatcacagagattcccaaatcctgtagcaaaattttatgccgctgaagttactttagct
gttgaatatttacatagccatgatatcatataccgtgatttgaaacctgaaaatattctt
ttggatagaaacgggcatattaaaattacagattttggtttcgcaaaagaagtcagcact
gttacctggacattatgtggtactcctgattatattgctcctgaagttattacgaccaag
ccatacaataagtctgtcgactggtggtctttgggtgttcttatttttgaaatgttagct
ggttatactccattttatgattcaactccaatgaaaacatacgagaaaatcttatctggt
aagattcattttccaagcttcatgggacctgatgtcattgacttattatcgaaattgatc
actgccgatttaaccagaagattggggaatttaatgaatggaccatcagacatcagaaac
cacccatggttcctggaagttgtatgggaaaaattattagctaaggatattgaaacgcca
tatgaaccacctattactgcaggagttggtgattcttcgttgttcgatcattacccagaa
gagaaattagattacggaacagtcggtgaggatccttatgcacaatatttccttgaattc
taa

DBGET integrated database retrieval system