KEGG   Debaryomyces hansenii: DEHA2F23892gHelp
Entry
DEHA2F23892g      CDS       T01026                                 

Definition
DEHA2F23892p
Orthology
K10739  
replication factor A2
Organism
dha  Debaryomyces hansenii
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:dha00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    DEHA2F23892g
   03420 Nucleotide excision repair
    DEHA2F23892g
   03430 Mismatch repair
    DEHA2F23892g
   03440 Homologous recombination
    DEHA2F23892g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:complement(1986937..1987719)
Genome map
AA seq 260 aa AA seqDB search
MSDFGGNYNNYGDGGFNTDIGNGGFQNENNGSQKQQLRSSLTPVTIKQITEATQPIPDGE
FQVHNVNLNLVSFVGVVRNVQDITSAILITIEDGTGSIEVRKWIDDSNAMDENEQEKYEM
NKYIYVTGALKEFNGKKNLQHATMRPITDHNEILYHHLSAISHHLKAQGLSARANGEQNQ
SQDNGLFVKDPHGMDVGTSIQDKILTVIRDNTSSMQEGVPVPFISQKLNVTDDLVLEQCS
ELIDNGKIYSGYDDSAYLAV
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgtcagattttggaggaaattataataactacggcgacggaggattcaatacagatatt
ggaaatggcggattccaaaatgaaaataatggatcgcagaagcagcagttacgttcaagc
ttaacgccagtgaccattaaacaaattacagaagctacacaaccaataccagacggagaa
ttccaagtccataatgttaatttaaacttggtatcgtttgtaggagttgtgagaaacgtg
caggacataacctctgccattcttattacaattgaagatggcactgggtcgattgaagta
cgtaaatggatagatgattccaatgcaatggatgaaaatgaacaggagaaatacgaaatg
aacaagtatatttatgtcacaggtgctttgaaggaatttaatggaaagaaaaacttacag
catgcgaccatgagaccaattactgatcataatgaaatcttgtatcaccacttaagcgct
atttcacaccacttaaaggcacaaggattgtctgctagagctaatggcgaacaaaatcaa
tctcaagataatggactttttgttaaggatccacatggcatggacgttggcacttcaatt
caagataagatcttaacagttattcgtgataacaccagcagtatgcaagaaggtgttcct
gtgcctttcatttctcaaaagttaaatgtgacggacgaccttgtgttagaacagtgttct
gaattaattgataacggtaagatttattccggatatgatgatagtgcttatttggctgtc
tga

DBGET integrated database retrieval system